E3 ubiquitin-protein ligase UBR2 (UBR2) Recombinant Protein | UBR2 recombinant protein

Recombinant Human E3 ubiquitin-protein ligase UBR2 (UBR2) , partial

Cat. Num. AAA1426551

• Gene Names: UBR2; C6orf133; bA49A4.1; dJ242G1.1; dJ392M17.3
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: E3 ubiquitin-protein ligase UBR2 (UBR2); Recombinant Human E3 ubiquitin-protein ligase UBR2 (UBR2); partial; UBR2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-439; Provide the full length of Isoform 2.
• Sequence: MASELEPEVQAIDRSLLECSAEEIAGKWLQATDLTREVYQHLAHYVPKIYCRGPNPFPQKEDMLAQHVLLGPMEWYLCGEDPAFGFPKLEQANKPSHLCGRVFKVGEPTYSCRDCAVDPTCVLCMECFLGSIHRDHRYRMTTSGGGGFCDCGDTEAWKEGPYCQKHELNTSEIEEEEDPLVHLSEDVIARTYNIFAITFRYAVEILTWEKESELPADLEMVEKSDTYYCMLFNDEVHTYEQVIYTLQKAVNCTQKEAIGFATTVDRDGRRSVRYGDFQYCEQAKSVIVRNTSRQTKPLKVQVMHSSIVAHQNFGLKLLSWLGSIIGYSDGLRRILCQVGLQEGPDGENSSLVDRLMLSDSKLWKGARSVYHQLFMSSLLMDLKYKKLFAVRFAKNYERLQSDYVTDDHDREFSVADLSVQIFTVPSLFSISAGRSGSPL
• Sequence Length: 439

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 296317280
• NCBI GeneID: 23304
• NCBI Accession #: NP_001171730.1
• NCBI GenBank Nucleotide #: NM_001184801.1
• UniProt Accession #: Q8IWV8; O15057; Q4VXK2; Q5TFH6; Q6P2I2; Q6ZUD0
• Molecular Weight: 200,540 Da
• NCBI Official Full Name: E3 ubiquitin-protein ligase UBR2 isoform 2
• NCBI Official Synonym Full Names: ubiquitin protein ligase E3 component n-recognin 2
• NCBI Official Symbol: UBR2
• NCBI Official Synonym Symbols: C6orf133; bA49A4.1; dJ242G1.1; dJ392M17.3
• NCBI Protein Information: E3 ubiquitin-protein ligase UBR2
• UniProt Protein Name: E3 ubiquitin-protein ligase UBR2
• Protein Family: E3 ubiquitin-protein ligase
• UniProt Gene Name: UBR2
• UniProt Synonym Gene Names: C6orf133; KIAA0349

NCBI Description

This gene encodes an E3 ubiquitin ligase of the N-end rule proteolytic pathway that targets proteins with destabilizing N-terminal residues for polyubiquitylation and proteasome-mediated degradation. Alternative splicing results in multiple transcript variants.[provided by RefSeq, May 2010]

Uniprot Description

E3 ubiquitin-protein ligase which is a component of the N-end rule pathway. Recognizes and binds to proteins bearing specific N-terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation. Plays a critical role in chromatin inactivation and chromosome-wide transcriptional silencing during meiosis via ubiquitination of histone H2A. Binds leucine and is a negative regulator of the leucine-mTOR signaling pathway, thereby controlling cell growth. Required for spermatogenesis, promotes, with Tex19.1, SPO11-dependent recombination foci to accumulate and drive robust homologous chromosome synapsis (). Polyubiquitinates LINE-1 retrotransposon encoded, LIRE1, which induces degradation, inhibiting LINE-1 retranstoposon mobilization ().