Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged FOXM1 is 1 ng/ml as a capture antibody.)

Mouse FOXM1 Monoclonal Antibody | anti-FOXM1 antibody

FOXM1 (Forkhead Box M1, FKHL16, FOXM1B, HFH-11, HFH11, HNF-3, INS-1, MPHOSPH2, MPP-2, MPP2, PIG29, TGT3, TRIDENT) (PE)

Gene Names
FOXM1; MPP2; HFH11; HNF-3; INS-1; MPP-2; PIG29; FKHL16; FOXM1A; FOXM1B; FOXM1C; HFH-11; TRIDENT; MPHOSPH2
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
FOXM1; Monoclonal Antibody; FOXM1 (Forkhead Box M1; FKHL16; FOXM1B; HFH-11; HFH11; HNF-3; INS-1; MPHOSPH2; MPP-2; MPP2; PIG29; TGT3; TRIDENT) (PE); Forkhead Box M1; TRIDENT; anti-FOXM1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2H4
Specificity
Recognizes FOXM1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-FOXM1 antibody
Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
FOXM1 (NP_973731, 22aa-110aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
NAPSETSEEEPKRSPAQQESNQAEASKEVAESNSCKFPAGIKIINHPTMPNTQVVAIPNNANIHSIITALTAKGKESGSSGPNKFILIS
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged FOXM1 is 1 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged FOXM1 is 1 ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to FOXM1 on HeLa cell. [antibody concentration 20 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to FOXM1 on HeLa cell. [antibody concentration 20 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to FOXM1 on HeLa cell. [antibody concentration 20 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to FOXM1 on HeLa cell. [antibody concentration 20 ug/ml])
Related Product Information for anti-FOXM1 antibody
Mouse monoclonal antibody raised against a full length recombinant FOXM1.
Product Categories/Family for anti-FOXM1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
88kDa
NCBI Official Full Name
forkhead box protein M1 isoform 1
NCBI Official Synonym Full Names
forkhead box M1
NCBI Official Symbol
FOXM1
NCBI Official Synonym Symbols
MPP2; HFH11; HNF-3; INS-1; MPP-2; PIG29; FKHL16; FOXM1A; FOXM1B; FOXM1C; HFH-11; TRIDENT; MPHOSPH2
NCBI Protein Information
forkhead box protein M1
UniProt Protein Name
Forkhead box protein M1
Protein Family
UniProt Gene Name
FOXM1
UniProt Synonym Gene Names
FKHL16; HFH11; MPP2; WIN; HFH-11; HNF-3/fork-head homolog 11
UniProt Entry Name
FOXM1_HUMAN

NCBI Description

The protein encoded by this gene is a transcriptional activator involved in cell proliferation. The encoded protein is phosphorylated in M phase and regulates the expression of several cell cycle genes, such as cyclin B1 and cyclin D1. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2011]

Uniprot Description

FOXM1: a transcriptional activator factor. Contains 1 fork-head domain. May play a role in the control of cell proliferation. Appears to be expressed only in adult organs containing proliferating/cycling cells or in response to growth factors. Also expressed in epithelial cell lines derived from tumors. Not expressed in resting cells. Phosphorylated in M (mitotic) phase. Three splice variant isoforms have been described. Isoform 1 and isoform 2 appear to be the only activators of gene transcription. Isoform 3, found in rat, does not seem to exist in human.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 12p13

Cellular Component: nucleoplasm; cytoplasm

Molecular Function: protein binding; DNA binding; sequence-specific DNA binding; transcription factor activity; protein kinase binding

Biological Process: transcription from RNA polymerase II promoter; regulation of Ras protein signal transduction; regulation of cell cycle; positive regulation of transcription, DNA-dependent; negative regulation of transcription from RNA polymerase II promoter; DNA repair; negative regulation of stress-activated MAPK cascade; liver development; cell cycle; regulation of cell proliferation; DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator; regulation of transcription, DNA-dependent; positive regulation of cell proliferation; positive regulation of transcription from RNA polymerase II promoter; mitotic cell cycle; regulation of cell growth; negative regulation of transcription, DNA-dependent; G2/M transition of mitotic cell cycle; vasculogenesis

Research Articles on FOXM1

Similar Products

Product Notes

The FOXM1 foxm1 (Catalog #AAA6184596) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's FOXM1 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FOXM1 foxm1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FOXM1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.