3-demethylubiquinone-9 3-methyltransferase (ubiG) Recombinant Protein | Sama_1730 recombinant protein
Recombinant Shewanella amazonensis 3-demethylubiquinone-9 3-methyltransferase (ubiG)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
3-demethylubiquinone-9 3-methyltransferase (ubiG); Recombinant Shewanella amazonensis 3-demethylubiquinone-9 3-methyltransferase (ubiG); Recombinant 3-demethylubiquinone-9 3-methyltransferase (ubiG); 3-demethylubiquinone-9 3-methyltransferase EC= 2.1.1.64; 2-polyprenyl-6-hydroxyphenyl methylase EC= 2.1.1.222 3; 4-dihydroxy-5-hexaprenylbenzoate methyltransferase; DHHB methyltransferase; Sama_1730 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-237aa; full length protein
Sequence
MSEALNVDIQEIAKFEKMAATWWDPDGEFKPLHQLNPLRLNYIDQTSGGLFGKKVLDVGC GGGILSESMARLGANVTGIDMGNEPLEVARLHALETGVSLNYERCTAEEHREVNREAYDV VTCMEMLEHVPDPLSVIAACCDMVKPGGYVFFSTINRNLRSYVETILGAEYLLKMLPVGT HDHGKFIRPSELIAMVDQTELLCKDATGVTYNPITGTFRYTSSVEVNYMIATVKPLE
Sequence Length
237
Species
Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26,268 Da
NCBI Official Full Name
3-demethylubiquinone-9 3-methyltransferase
NCBI Official Symbol
Sama_1730
NCBI Protein Information
3-demethylubiquinone-9 3-methyltransferase
UniProt Protein Name
Ubiquinone biosynthesis O-methyltransferase
UniProt Gene Name
ubiG
UniProt Synonym Gene Names
DHHB methyltransferase
UniProt Entry Name
UBIG_SHEAM
Uniprot Description
Function: Non-specific O-methyltransferase that catalyzes the 2 O-methylation steps in the ubiquinone biosynthetic pathway
By similarity. HAMAP-Rule MF_00472
Catalytic activity: S-adenosyl-L-methionine + 3-demethylubiquinone-n = S-adenosyl-L-homocysteine + ubiquinone-n. HAMAP-Rule MF_00472S-adenosyl-L-methionine + 3-(all-trans-polyprenyl)benzene-1,2-diol = S-adenosyl-L-homocysteine + 2-methoxy-6-(all-trans-polyprenyl)phenol. HAMAP-Rule MF_00472
Pathway: Cofactor biosynthesis; ubiquinone biosynthesis. HAMAP-Rule MF_00472
Sequence similarities: Belongs to the methyltransferase superfamily. UbiG/COQ3 family.
Similar Products
Product Notes
The Sama_1730 ubig (Catalog #AAA1163962) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-237aa; full length protein. The amino acid sequence is listed below: MSEALNVDIQ EIAKFEKMAA TWWDPDGEFK PLHQLNPLRL NYIDQTSGGL FGKKVLDVGC GGGILSESMA RLGANVTGID MGNEPLEVAR LHALETGVSL NYERCTAEEH REVNREAYDV VTCMEMLEHV PDPLSVIAAC CDMVKPGGYV FFSTINRNLR SYVETILGAE YLLKMLPVGT HDHGKFIRPS ELIAMVDQTE LLCKDATGVT YNPITGTFRY TSSVEVNYMI ATVKPLE. It is sometimes possible for the material contained within the vial of "3-demethylubiquinone-9 3-methyltransferase (ubiG), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
