Probable ubiquinone biosynthesis protein UbiB (ubiB) Recombinant Protein | PFLU0387 recombinant protein
Recombinant Pseudomonas fluorescens Probable ubiquinone biosynthesis protein UbiB (ubiB)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable ubiquinone biosynthesis protein UbiB (ubiB); Recombinant Pseudomonas fluorescens Probable ubiquinone biosynthesis protein UbiB (ubiB); Recombinant Probable ubiquinone biosynthesis protein UbiB (ubiB); Probable ubiquinone biosynthesis protein UbiB; PFLU0387 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-534
Sequence
MKLLAVRRLFRIQRVVIRYRLDDLLFALPLPWFLLAVRYVLPWRWFPRKQLELSRGARLRLALQDLGPIFIKFGQILSTRRDLLPEDIADELMLLQDRVPPFDSQQSMKLIEEQLGKKISEVFSRFDVDPLASASVAQVHAAQLKTGEEVVVKVIRPGLKPIIGQDLAWLFILARAAERFSADARLLHPVDVVADYEKTIYDELDLLREAANASQLKRNFEGSPLLYVPQVYWDWCRPKVLVMERIYGVQVTDLATLADQRTDMKMLAERGVEIFFTQVFRDSFFHADMHPGNIFVSTVNPWSPQYIAIDCGIVGSLTPEDQDYLARNLFAFFKRDYRRVAQLHIDSGWVPAETKLNEFEAAIRTVCEPIFEKPLKDISFGQVLMRLFQTARRFNMEVQPQLVLLQKTLLNIEGLGRQLYPDLDLWNTAQPFLERWMRERMSPKTVLGNLHSQMEQLPHLANMTRDLLERMSQPHAKDPAPPWKKRKDDWFLRLLGAAHLVGGVMLAIGGPLNQLGHWPAGIMVAVGVYLIVRR
Sequence Length
534
Species
Pseudomonas fluorescens (strain SBW25)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61,655 Da
NCBI Official Full Name
putative ubiquinone biosynthesis-like protein
NCBI Official Symbol
PFLU0387
NCBI Protein Information
putative ubiquinone biosynthesis-like protein
UniProt Protein Name
Probable ubiquinone biosynthesis protein UbiB
UniProt Gene Name
ubiB
UniProt Entry Name
UBIB_PSEFS
Uniprot Description
Function: Required, probably indirectly, for the hydroxylation of 2-octaprenylphenol to 2-octaprenyl-6-hydroxy-phenol, the fourth step in ubiquinone biosynthesis
By similarity. HAMAP-Rule MF_00414
Subcellular location: Cell inner membrane; Multi-pass membrane protein
By similarity HAMAP-Rule MF_00414.
Sequence similarities: Belongs to the ABC1 family. UbiB subfamily.
Similar Products
Product Notes
The PFLU0387 ubib (Catalog #AAA1171249) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-534. The amino acid sequence is listed below: MKLLAVRRLF RIQRVVIRYR LDDLLFALPL PWFLLAVRYV LPWRWFPRKQ LELSRGARLR LALQDLGPIF IKFGQILSTR RDLLPEDIAD ELMLLQDRVP PFDSQQSMKL IEEQLGKKIS EVFSRFDVDP LASASVAQVH AAQLKTGEEV VVKVIRPGLK PIIGQDLAWL FILARAAERF SADARLLHPV DVVADYEKTI YDELDLLREA ANASQLKRNF EGSPLLYVPQ VYWDWCRPKV LVMERIYGVQ VTDLATLADQ RTDMKMLAER GVEIFFTQVF RDSFFHADMH PGNIFVSTVN PWSPQYIAID CGIVGSLTPE DQDYLARNLF AFFKRDYRRV AQLHIDSGWV PAETKLNEFE AAIRTVCEPI FEKPLKDISF GQVLMRLFQT ARRFNMEVQP QLVLLQKTLL NIEGLGRQLY PDLDLWNTAQ PFLERWMRER MSPKTVLGNL HSQMEQLPHL ANMTRDLLER MSQPHAKDPA PPWKKRKDDW FLRLLGAAHL VGGVMLAIGG PLNQLGHWPA GIMVAVGVYL IVRR. It is sometimes possible for the material contained within the vial of "Probable ubiquinone biosynthesis protein UbiB (ubiB), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
