Ubiquitin-conjugating enzyme E2 W (Ube2w) Recombinant Protein | Ube2w recombinant protein

Recombinant Mouse Ubiquitin-conjugating enzyme E2 W (Ube2w)

Cat. Num. AAA1397619

• Gene Names: Ube2w; 6130401J04Rik
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Ubiquitin-conjugating enzyme E2 W (Ube2w); Recombinant Mouse Ubiquitin-conjugating enzyme E2 W (Ube2w); Ube2w recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-151, full length protein
• Sequence: MASMQKRLQKELLALQNDPPPGMTLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKFSSRYPFDSPQVMFTGENIPIHPHVYSNGHICLSILTEDWSPALSVQSVCLSIISMLSSCKEKRRPPDNSFYVRTCNKNPKKTKWWYHDDTC
• Sequence Length: 151

• Species: Mouse
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 401891882
• NCBI GeneID: 66799
• NCBI Accession #: NP_080049.2
• NCBI GenBank Nucleotide #: NM_025773.3
• UniProt Accession #: Q8VDW4; Q8BVJ8; Q9D5H3
• Molecular Weight: 17,345 Da
• NCBI Official Full Name: ubiquitin-conjugating enzyme E2 W isoform 1
• NCBI Official Synonym Full Names: ubiquitin-conjugating enzyme E2W (putative)
• NCBI Official Symbol: Ube2w
• NCBI Official Synonym Symbols: 6130401J04Rik
• NCBI Protein Information: ubiquitin-conjugating enzyme E2 W
• UniProt Protein Name: Ubiquitin-conjugating enzyme E2 W
• Protein Family: Ubiquitin-conjugating enzyme
• UniProt Gene Name: Ube2w

Uniprot Description

Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. Specifically monoubiquitinates the N-terminus of various substrates, including ATXN3, MAPT/TAU, POLR2H/RPB8 and STUB1/CHIP, by recognizing backbone atoms of disordered N-termini (PubMed:21855799, PubMed:21229326). Involved in degradation of misfolded chaperone substrates by mediating monoubiquitination of STUB1/CHIP, leading to recruitment of ATXN3 to monoubiquitinated STUB1/CHIP, and restriction of the length of ubiquitin chain attached to STUB1/CHIP substrates by ATXN3 (PubMed:21855799). After UV irradiation, but not after mitomycin-C (MMC) treatment, acts as a specific E2 ubiquitin-conjugating enzyme for the Fanconi anemia complex by associating with E3 ubiquitin-protein ligase FANCL and catalyzing monoubiquitination of FANCD2, a key step in the DNA damage pathway (PubMed:21229326). In vitro catalyzes 'Lys-11'-linked polyubiquitination. UBE2W-catalyzed ubiquitination occurs also in the presence of inactive RING/U-box type E3s, i.e. lacking the active site cysteine residues to form thioester bonds with ubiquitin, or even in the absence of E3, albeit at a slower rate ().