Ubiquitin-conjugating enzyme E2 variant 1 (UBE2V1) Recombinant Protein | UBE2V1 recombinant protein

Recombinant Chicken Ubiquitin-conjugating enzyme E2 variant 1 (UBE2V1)

Cat. Num. AAA1472348

• Gene Names: UBE2V1; UEV-1; CROC-1B
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Ubiquitin-conjugating enzyme E2 variant 1 (UBE2V1); Recombinant Chicken Ubiquitin-conjugating enzyme E2 variant 1 (UBE2V1); UBE2V1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-145, Full length protein
• Sequence: MAATTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTIYENRIYSLKIECGPKYPEAPPFVRFVTKINMNGVNSSNGVVDPRAISVLAKWQNSFSIKVVLQELRRLMMSKENMKLPQPPEGQCYSN
• Sequence Length: 145

• Species: Chicken
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for UBE2V1 recombinant protein

Ubiquitin-conjugating E2 enzyme variant proteins constitute a distinct subfamily within the E2 protein family. They have sequence similarity to other ubiquitin-conjugating enzymes but lack the conserved cysteine residue that is critical for the catalytic activity of E2s. This protein is located in the nucleus and can cause transcriptional activation of the human FOS proto-oncogene. It is thought to be involved in the control of differentiation by altering cell cycle behavior. Multiple alternatively spliced transcripts encoding different isoforms have been described for this gene. A pseudogene has been identified which is also located on chromosome 20. Co-transcription of this gene and the neighboring upstream gene generates a rare transcript (Kua-UEV), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product.

NCBI and Uniprot Product Information

• NCBI GI #: 326633233
• NCBI GeneID: 100538349
• NCBI Accession #: NP_001192026.1
• NCBI GenBank Nucleotide #: NM_001205097.1
• UniProt Accession #: Q90879
• Molecular Weight: 16,335 Da
• NCBI Official Full Name: ubiquitin-conjugating enzyme E2 variant 1
• NCBI Official Synonym Full Names: ubiquitin conjugating enzyme E2 V1
• NCBI Official Symbol: UBE2V1
• NCBI Official Synonym Symbols: UEV-1; CROC-1B
• NCBI Protein Information: ubiquitin-conjugating enzyme E2 variant 1
• UniProt Protein Name: Ubiquitin-conjugating enzyme E2 variant 1
• UniProt Gene Name: UBE2V1
• UniProt Synonym Gene Names: UEV-1

Uniprot Description

Has no ubiquitin ligase activity on its own. The UBE2V1-UBE2N heterodimer catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through 'Lys-63'. This type of poly-ubiquitination activates IKK and does not seem to involve protein degradation by the proteasome. Plays a role in the activation of NF-kappa-B. Mediates transcriptional activation of target genes. Plays a role in the control of progress through the cell cycle and differentiation. Plays a role in the error-free DNA repair pathway and contributes to the survival of cells after DNA damage ().