Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: UBE2V1Sample Tissue: Human U937 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human UBE2V1 Polyclonal Antibody | anti-UBE2V1 antibody

UBE2V1 Antibody - middle region

Gene Names
UBE2V1; CIR1; UEV1; CROC1; UBE2V; UEV-1; UEV1A; CROC-1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
UBE2V1; Polyclonal Antibody; UBE2V1 Antibody - middle region; anti-UBE2V1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IYENRIYSLKIECGPKYPEAPPFVRFVTKINMNGVNSSNGVVDPRAISVL
Sequence Length
221
Applicable Applications for anti-UBE2V1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human UBE2V1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: UBE2V1Sample Tissue: Human U937 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: UBE2V1Sample Tissue: Human U937 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-UBE2V1 antibody
Ubiquitin-conjugating E2 enzyme variant proteins constitute a distinct subfamily within the E2 protein family. They have sequence similarity to other ubiquitin-conjugating enzymes but lack the conserved cysteine residue that is critical for the catalytic activity of E2s. The protein encoded by this gene is located in the nucleus and can cause transcriptional activation of the human FOS proto-oncogene. It is thought to be involved in the control of differentiation by altering cell cycle behavior. Alternatively spliced transcript variants encoding multiple isoforms have been described for this gene, and multiple pseudogenes of this gene have been identified. Co-transcription of this gene and the neighboring upstream gene generates a rare transcript (Kua-UEV), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24 kDa
NCBI Official Full Name
ubiquitin-conjugating enzyme E2 variant 1 isoform d
NCBI Official Synonym Full Names
ubiquitin conjugating enzyme E2 V1
NCBI Official Symbol
UBE2V1
NCBI Official Synonym Symbols
CIR1; UEV1; CROC1; UBE2V; UEV-1; UEV1A; CROC-1
NCBI Protein Information
ubiquitin-conjugating enzyme E2 variant 1
UniProt Protein Name
Ubiquitin-conjugating enzyme E2 variant 1
UniProt Gene Name
UBE2V1
UniProt Synonym Gene Names
CROC1; UBE2V; UEV1; UEV-1
UniProt Entry Name
UB2V1_HUMAN

NCBI Description

Ubiquitin-conjugating E2 enzyme variant proteins constitute a distinct subfamily within the E2 protein family. They have sequence similarity to other ubiquitin-conjugating enzymes but lack the conserved cysteine residue that is critical for the catalytic activity of E2s. The protein encoded by this gene is located in the nucleus and can cause transcriptional activation of the human FOS proto-oncogene. It is thought to be involved in the control of differentiation by altering cell cycle behavior. Alternatively spliced transcript variants encoding multiple isoforms have been described for this gene, and multiple pseudogenes of this gene have been identified. Co-transcription of this gene and the neighboring upstream gene generates a rare transcript (Kua-UEV), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product. [provided by RefSeq, Apr 2012]

Uniprot Description

UBE2V1: Has no ubiquitin ligase activity on its own. The UBE2V1- UBE2N heterodimer catalyzes the synthesis of non-canonical poly- ubiquitin chains that are linked through Lys-63. This type of poly-ubiquitination activates IKK and does not seem to involve protein degradation by the proteasome. Plays a role in the activation of NF-kappa-B mediated by IL1B, TNF, TRAF6 and TRAF2. Mediates transcriptional activation of target genes. Plays a role in the control of progress through the cell cycle and differentiation. Plays a role in the error-free DNA repair pathway and contributes to the survival of cells after DNA damage. Belongs to the ubiquitin-conjugating enzyme family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 20q13.2

Cellular Component: protein complex; ubiquitin conjugating enzyme complex; cytoplasm; nucleus; cytosol; ubiquitin ligase complex

Molecular Function: protein binding; small conjugating protein ligase activity; ubiquitin conjugating enzyme binding; ubiquitin protein ligase binding

Biological Process: positive regulation of I-kappaB kinase/NF-kappaB cascade; protein polyubiquitination; error-free postreplication DNA repair; postreplication repair; positive regulation of transcription, DNA-dependent; T cell receptor signaling pathway; toll-like receptor 10 signaling pathway; activation of NF-kappaB transcription factor; toll-like receptor 2 signaling pathway; toll-like receptor 5 signaling pathway; MyD88-dependent toll-like receptor signaling pathway; regulation of DNA repair; regulation of transcription, DNA-dependent; toll-like receptor signaling pathway; innate immune response; toll-like receptor 9 signaling pathway; cell differentiation; toll-like receptor 4 signaling pathway

Research Articles on UBE2V1

Similar Products

Product Notes

The UBE2V1 ube2v1 (Catalog #AAA3221859) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UBE2V1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's UBE2V1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the UBE2V1 ube2v1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IYENRIYSLK IECGPKYPEA PPFVRFVTKI NMNGVNSSNG VVDPRAISVL. It is sometimes possible for the material contained within the vial of "UBE2V1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.