Ubiquitin-conjugating enzyme E2 K (UBE2K) Recombinant Protein | UBE2K recombinant protein

Recombinant Bovine Ubiquitin-conjugating enzyme E2 K (UBE2K)

Cat. Num. AAA956674

• Gene Names: UBE2K; LIG; HIP2; HYPG; E2-25K
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Ubiquitin-conjugating enzyme E2 K (UBE2K); Recombinant Bovine Ubiquitin-conjugating enzyme E2 K (UBE2K); UBE2K recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-200, Full length protein
• Sequence: ANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQYKQNPEMFKQTARLWAHVYAGAPVSSPEYTKKIENLCAMGFDRNAVIVALSSKSWDVETATELLLSN
• Sequence Length: 199

• Species: Bovine
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for UBE2K recombinant protein

This protein belongs to the ubiquitin-conjugating enzyme family. This protein interacts with RING finger proteins, and it can ubiquitinate huntingtin, the gene product for Huntington s disease. Known functions for this protein include a role in aggregate formation of expanded polyglutamine proteins and the suppression of apoptosis in polyglutamine diseases, a role in the dislocation of newly synthesized MHC class I heavy chains from the endoplasmic reticulum, and involvement in foam cell formation. Multiple transcript variants encoding different isoforms have been identified for this gene.

NCBI and Uniprot Product Information

• NCBI GI #: 27806587
• NCBI GeneID: 281225
• NCBI Accession #: NP_776505.1
• NCBI GenBank Nucleotide #: NM_174080.2
• UniProt Accession #: P61085; O54806; P27924; Q16721; Q9CVV9; A5PK22
• Molecular Weight: 22,407 Da
• NCBI Official Full Name: ubiquitin-conjugating enzyme E2 K
• NCBI Official Synonym Full Names: ubiquitin conjugating enzyme E2 K
• NCBI Official Symbol: UBE2K
• NCBI Official Synonym Symbols: LIG; HIP2; HYPG; E2-25K
• NCBI Protein Information: ubiquitin-conjugating enzyme E2 K
• UniProt Protein Name: Ubiquitin-conjugating enzyme E2 K
• Protein Family: Ubiquitin-conjugating enzyme
• UniProt Gene Name: UBE2K
• UniProt Synonym Gene Names: HIP2; HIP-2; Ubiquitin-conjugating enzyme E2(25K); Ubiquitin-conjugating enzyme E2-25K

Uniprot Description

Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro, in the presence or in the absence of BRCA1-BARD1 E3 ubiquitin-protein ligase complex, catalyzes the synthesis of 'Lys-48'-linked polyubiquitin chains. Does not transfer ubiquitin directly to but elongates monoubiquitinated substrate protein. Mediates the selective degradation of short-lived and abnormal proteins, such as the endoplasmic reticulum-associated degradation (ERAD) of misfolded lumenal proteins. Ubiquitinates huntingtin. May mediate foam cell formation by the suppression of apoptosis of lipid-bearing macrophages through ubiquitination and subsequence degradation of p53/TP53 (). Proposed to be involved in ubiquitination and proteolytic processing of NF-kappa-B; in vitro supports ubiquitination of NFKB1.