SUMO-conjugating enzyme UBC9-A (ube2ia) Recombinant Protein | ube2ia recombinant protein
Recombinant Danio rerio SUMO-conjugating enzyme UBC9-A (ube2ia)
Gene Names
ube2ib; ubc9; ube2i; zUbc9; ube2ia
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
SUMO-conjugating enzyme UBC9-A (ube2ia); Recombinant Danio rerio SUMO-conjugating enzyme UBC9-A (ube2ia); ube2ia recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-158, Full length protein
Sequence
MSGIALSRLAQERKAWRKDHPFGFVAVPMKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFSPS
Sequence Length
158
Species
Zebrafish
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18,053 Da
NCBI Official Full Name
SUMO-conjugating enzyme UBC9-A
NCBI Official Synonym Full Names
ubiquitin-conjugating enzyme E2Ib
NCBI Official Symbol
ube2ib
NCBI Official Synonym Symbols
ubc9; ube2i; zUbc9; ube2ia
NCBI Protein Information
SUMO-conjugating enzyme UBC9-A
UniProt Protein Name
SUMO-conjugating enzyme UBC9-A
Protein Family
UniProt Gene Name
ube2ia
UniProt Synonym Gene Names
ubc9a; ube2i
Uniprot Description
Accepts the ubiquitin-like proteins sumo1, sumo2 and sumo3 from the uble1a-uble1b E1 complex and catalyzes their covalent attachment to other proteins with the help of an E3 ligase such as ranbp2 or cbx4. Essential for nuclear architecture and chromosome segregation (). Mediates nuclear localization of vsx1. Required for progression through mitosis during organogenesis.
Research Articles on ube2ia
Similar Products
Product Notes
The ube2ia ube2ia (Catalog #AAA1349515) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-158, Full length protein. The amino acid sequence is listed below: MSGIALSRLA QERKAWRKDH PFGFVAVPMK NPDGTMNLMN WECAIPGKKG TPWEGGLFKL RMLFKDDYPS SPPKCKFEPP LFHPNVYPSG TVCLSILEED KDWRPAITIK QILLGIQELL NEPNIQDPAQ AEAYTIYCQN RVEYEKRVRA QAKKFSPS. It is sometimes possible for the material contained within the vial of "SUMO-conjugating enzyme UBC9-A (ube2ia), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
