Tyrosinase (TYR) Recombinant Protein | TYR recombinant protein

Recombinant Cat Tyrosinase (TYR)

Cat. Num. AAA956522

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Tyrosinase (TYR); Recombinant Cat Tyrosinase (TYR); TYR recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-80, Full length protein
• Sequence: LEEYNSRQALCDGTPEGPLLRNPGNHDKARTPRLPSSADVEFCLSLTQYESDSMDKAANFSFRNTLEGFASPLTGIADAS
• Sequence Length: 80

• Species: Felis catus (Cat) (Felis silvestris catus)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for TYR recombinant protein

The enzyme encoded by this gene catalyzes the first 2 steps, and at least 1 subsequent step, in the conversion of tyrosine to melanin. The enzyme has both tyrosine hydroxylase and dopa oxidase catalytic activities, and requires copper for function. Mutations in this gene result in oculocutaneous albinism, and nonpathologic polymorphisms result in skin pigmentation variation. The human genome contains a pseudogene similar to the 3 half of this gene.

NCBI and Uniprot Product Information

• NCBI GI #: 1717837
• NCBI GeneID: 751100
• UniProt Accession #: P55033
• Molecular Weight: 8,694 Da
• NCBI Official Full Name: Tyrosinase
• NCBI Official Symbol: TYR
• NCBI Protein Information: LOW QUALITY PROTEIN: tyrosinase
• UniProt Protein Name: Tyrosinase
• UniProt Gene Name: TYR

Uniprot Description

This is a copper-containing oxidase that functions in the formation of pigments such as melanins and other polyphenolic compounds. Catalyzes the initial and rate limiting step in the cascade of reactions leading to melanin production from tyrosine. In addition to hydroxylating tyrosine to DOPA (3,4-dihydroxyphenylalanine), also catalyzes the oxidation of DOPA to DOPA-quinone, and possibly the oxidation of DHI (5,6-dihydroxyindole) to indole-5,6 quinone.