Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Tumor suppressor candidate 3 (TUSC3) Recombinant Protein | TUSC3 recombinant protein

Recombinant Human Tumor suppressor candidate 3 (TUSC3)

Gene Names
TUSC3; M33; N33; MRT7; MRT22; OST3A; D8S1992
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Tumor suppressor candidate 3 (TUSC3); Recombinant Human Tumor suppressor candidate 3 (TUSC3); TUSC3 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
42-348aa; full length protein
Sequence
QKKKENLLAEKVEQLMEWSSRRSIFRMNGDKFRKFIKAPPRNYSMIVMFTALQPQRQCSV CRQANEEYQILANSWRYSSAFCNKLFFSMVDYDEGTDVFQQLNMNSAPTFMHFPPKGRPK RADTFDLQRIGFAAEQLAKWIADRTDVHIRVFRPPNYSGTIALALLVSLVGGLLYLRRNN LEFIYNKTGWAMVSLCIVFAMTSGQMWNHIRGPPYAHKNPHNGQVSYIHGSSQAQFVAES HIILVLNAAITMGMVLLNEAATSKGDVGKRRIICLVGLGLVVFFFSFLLSIFRSKYHGYP YSDLDFE
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for TUSC3 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39,558 Da
NCBI Official Full Name
tumor suppressor candidate 3 isoform a
NCBI Official Synonym Full Names
tumor suppressor candidate 3
NCBI Official Symbol
TUSC3
NCBI Official Synonym Symbols
M33; N33; MRT7; MRT22; OST3A; D8S1992
NCBI Protein Information
tumor suppressor candidate 3
UniProt Protein Name
Tumor suppressor candidate 3
UniProt Gene Name
TUSC3
UniProt Synonym Gene Names
N33
UniProt Entry Name
TUSC3_HUMAN

NCBI Description

This gene is a candidate tumor suppressor gene. It is located within a homozygously deleted region of a metastatic prostate cancer. The gene is expressed in most nonlymphoid human tissues including prostate, lung, liver, and colon. Expression was also detected in many epithelial tumor cell lines. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

TUSC3: Magnesium transporter. May be involved in N- glycosylation through its association with N-oligosaccharyl transferase. Defects in TUSC3 are the cause of mental retardation autosomal recessive type 7 (MRT7); also known as mental retardation non-syndromic autosomal recessive 7. Mental retardation is characterized by significantly sub-average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period. Non- syndromic mental retardation patients do not manifest other clinical signs. Belongs to the OST3/OST6 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 8p22

Cellular Component: endoplasmic reticulum membrane; integral to plasma membrane; mitochondrion; oligosaccharyl transferase complex; plasma membrane

Molecular Function: dolichyl-diphosphooligosaccharide-protein glycotransferase activity; magnesium ion transmembrane transporter activity

Biological Process: cognition; magnesium ion transport; protein amino acid N-linked glycosylation; protein amino acid N-linked glycosylation via asparagine; transmembrane transport

Disease: Mental Retardation, Autosomal Recessive 7

Research Articles on TUSC3

Similar Products

Product Notes

The TUSC3 tusc3 (Catalog #AAA7032359) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 42-348aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the TUSC3 tusc3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: QKKKENLLAE KVEQLMEWSS RRSIFRMNGD KFRKFIKAPP RNYSMIVMFT ALQPQRQCSV CRQANEEYQI LANSWRYSSA FCNKLFFSMV DYDEGTDVFQ QLNMNSAPTF MHFPPKGRPK RADTFDLQRI GFAAEQLAKW IADRTDVHIR VFRPPNYSGT IALALLVSLV GGLLYLRRNN LEFIYNKTGW AMVSLCIVFA MTSGQMWNHI RGPPYAHKNP HNGQVSYIHG SSQAQFVAES HIILVLNAAI TMGMVLLNEA ATSKGDVGKR RIICLVGLGL VVFFFSFLLS IFRSKYHGYP YSDLDFE. It is sometimes possible for the material contained within the vial of "Tumor suppressor candidate 3 (TUSC3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.