Protein N-terminal glutamine amidohydrolase (tun) Recombinant Protein | tun recombinant protein
Recombinant Drosophila virilis Protein N-terminal glutamine amidohydrolase (tun)
Gene Names
DvirGJ18123; dvir_GLEANR_269; GJ18123
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein N-terminal glutamine amidohydrolase (tun); Recombinant Drosophila virilis Protein N-terminal glutamine amidohydrolase (tun); tun recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-205, full length protein
Sequence
MTTDFLFPKIADCSYVSCYCEENVWKLCEQVKRTRPEELSKCYAVFVSNEGRTVPLWRQKAGRGDDQVVIWDYHVFFMHNPLPNRCLVFDLDTTLPFPTYFHKYVTETFRSDLALRPEHHRFFRVIPADTYLIEFSSDRRHMRRPDGSWIKPPPSYPPILSNTNLHCLGDFICMSAGKGPGAVYSLSEFVQNFYKSPHVGVQQNK
Sequence Length
205
Species
Drosophila virilis (Fruit fly)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23,940 Da
NCBI Official Full Name
uncharacterized protein Dvir_GJ18123, isoform B
NCBI Official Symbol
DvirGJ18123
NCBI Official Synonym Symbols
dvir_GLEANR_269; GJ18123
NCBI Protein Information
GJ18123 gene product from transcript GJ18123-RF
UniProt Protein Name
Protein N-terminal glutamine amidohydrolase
Protein Family
UniProt Gene Name
tun
UniProt Synonym Gene Names
N-terminal Gln amidase; Nt(Q)-amidase
Uniprot Description
Mediates the side-chain deamidation of N-terminal glutamine residues to glutamate, an important step in N-end rule pathway of protein degradation. Conversion of the resulting N-terminal glutamine to glutamate renders the protein susceptible to arginylation, polyubiquitination and degradation as specified by the N-end rule. Does not act on substrates with internal or C-terminal glutamine and does not act on non-glutamine residues in any position.
Similar Products
Product Notes
The tun tun (Catalog #AAA1264203) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-205, full length protein. The amino acid sequence is listed below: MTTDFLFPKI ADCSYVSCYC EENVWKLCEQ VKRTRPEELS KCYAVFVSNE GRTVPLWRQK AGRGDDQVVI WDYHVFFMHN PLPNRCLVFD LDTTLPFPTY FHKYVTETFR SDLALRPEHH RFFRVIPADT YLIEFSSDRR HMRRPDGSWI KPPPSYPPIL SNTNLHCLGD FICMSAGKGP GAVYSLSEFV QNFYKSPHVG VQQNK. It is sometimes possible for the material contained within the vial of "Protein N-terminal glutamine amidohydrolase (tun), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
