Thiosulfate sulfurtransferase (Tst) Recombinant Protein | Tst recombinant protein
Recombinant Rat Thiosulfate sulfurtransferase (Tst)
Gene Names
Tst; RHODAN
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Thiosulfate sulfurtransferase (Tst); Recombinant Rat Thiosulfate sulfurtransferase (Tst); Tst recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-297, Full length protein
Sequence
VHQVLYRALVSTKWLAESIRSGKVGPSLRVLDASWYSPGTRQARKEYQERHVPGASFFDIEECRDTTSPYEMMLPSEAHFGDYVGNLGISNDTHVVVYDGDDLGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPVTSEPSRPEPAVFKATLNRSLLKTYEQVLENLQSKRFQLVDSRAQGRYLGTQPEPDAVGLDSGHIRGSVNVPFMNFLTEDGFEKSPEELRAIFQDKKVDLSQPLIATCRKGVTACHIALAAYLCGKPDVAVYDGSWSEWFRRAPPETRVSQGKSGKA
Sequence Length
296
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Tst recombinant protein
The product of this gene is a mitochondrial matrix enzyme that is encoded by the nucleus. It may play roles in cyanide detoxification, the formation of iron-sulfur proteins, and the modification of sulfur-containing enzymes. The gene product contains two highly conservative domains (rhodanese homology domains), suggesting these domains have a common evolutionary origin.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
33,407 Da
NCBI Official Full Name
thiosulfate sulfurtransferase
NCBI Official Synonym Full Names
thiosulfate sulfurtransferase
NCBI Official Symbol
Tst
NCBI Official Synonym Symbols
RHODAN
NCBI Protein Information
thiosulfate sulfurtransferase
UniProt Protein Name
Thiosulfate sulfurtransferase
Protein Family
UniProt Gene Name
Tst
NCBI Description
mitochondrial matrix enzyme; may play a role in cyanide detoxification and the formation of iron-sulfur complexes [RGD, Feb 2006]
Uniprot Description
Together with MRPL18, acts as a mitochondrial import factor for the cytosolic 5S rRNA. Only the nascent unfolded cytoplasmic form is able to bind to the 5S rRNA (). Involved in the formation of iron-sulfur complexes, cyanide detoxification or modification of sulfur-containing enzymes. Other thiol compounds, besides cyanide, can act as sulfur ion acceptors. Also has weak mercaptopyruvate sulfurtransferase (MST) activity.
Similar Products
Product Notes
The Tst tst (Catalog #AAA956053) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-297, Full length protein. The amino acid sequence is listed below: VHQVLYRALV STKWLAESIR SGKVGPSLRV LDASWYSPGT RQARKEYQER HVPGASFFDI EECRDTTSPY EMMLPSEAHF GDYVGNLGIS NDTHVVVYDG DDLGSFYAPR VWWMFRVFGH RTVSVLNGGF RNWLKEGHPV TSEPSRPEPA VFKATLNRSL LKTYEQVLEN LQSKRFQLVD SRAQGRYLGT QPEPDAVGLD SGHIRGSVNV PFMNFLTEDG FEKSPEELRA IFQDKKVDLS QPLIATCRKG VTACHIALAA YLCGKPDVAV YDGSWSEWFR RAPPETRVSQ GKSGKA. It is sometimes possible for the material contained within the vial of "Thiosulfate sulfurtransferase (Tst), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
