Tumor susceptibility gene 101 protein (TSG101) Recombinant Protein | TSG101 recombinant protein

Recombinant Human Tumor susceptibility gene 101 protein (TSG101), partial

Cat. Num. AAA9018613

• Gene Names: TSG101; TSG10; VPS23
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Tumor susceptibility gene 101 protein (TSG101); Recombinant Human Tumor susceptibility gene 101 protein (TSG101); partial; Tumor susceptibility gene 101 protein(ESCRT-I complex subunit TSG101); TSG101 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-145aa, Partial
• Sequence: MAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRP

• Species: Homo sapiens (Human)
• Relevance: Component of the ESCRT-I complex, a regulator of vesicular trafficking process. Binds to ubiquitinated cargo proteins and is required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies (MVBs). Mediates the association between the ESCRT-0 and ESCRT-I complex. Required for completion of cytokinesis; the function requires CEP55. May be involved in cell growth and differentiation. Acts as a negative growth regulator. Involved in the budding of many viruses through an interaction with viral proteins that contain a late-budding motif P-[ST]-A-P. This interaction is essential for viral particle budding of numerous retroviruses. Required for the exosomal release of SDCBP, CD63 and syndecan (PubMed:22660413). It may also play a role in the extracellular release of microvesicles that differ from the exosomes (PubMed:22315426).
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

Product Categories/Family for TSG101 recombinant protein

Others

References

"The TSG101 tumor susceptibility gene is located in chromosome 11 band p15 and is mutated in human breast cancer."Li L., Li X., Francke U., Cohen S.N.Cell 88:143-154(1997)

NCBI and Uniprot Product Information

• NCBI GI #: 5454140
• NCBI GeneID: 7251
• NCBI Accession #: NP_006283.1
• NCBI GenBank Nucleotide #: NM_006292.3
• UniProt Accession #: Q99816; Q9BUM5
• Molecular Weight: 43,944 Da
• NCBI Official Full Name: tumor susceptibility gene 101 protein
• NCBI Official Synonym Full Names: tumor susceptibility gene 101
• NCBI Official Symbol: TSG101
• NCBI Official Synonym Symbols: TSG10; VPS23
• NCBI Protein Information: tumor susceptibility gene 101 protein; tumor susceptibility protein; ESCRT-I complex subunit TSG101
• UniProt Protein Name: Tumor susceptibility gene 101 protein
• Protein Family: Tumor susceptibility gene 101 protein
• UniProt Gene Name: TSG101
• UniProt Entry Name: TS101_HUMAN

NCBI Description

The protein encoded by this gene belongs to a group of apparently inactive homologs of ubiquitin-conjugating enzymes. The gene product contains a coiled-coil domain that interacts with stathmin, a cytosolic phosphoprotein implicated in tumorigenesis. The protein may play a role in cell growth and differentiation and act as a negative growth regulator. In vitro steady-state expression of this tumor susceptibility gene appears to be important for maintenance of genomic stability and cell cycle regulation. Mutations and alternative splicing in this gene occur in high frequency in breast cancer and suggest that defects occur during breast cancer tumorigenesis and/or progression. [provided by RefSeq, Jul 2008]

Uniprot Description

TSG101: Component of the ESCRT-I complex, a regulator of vesicular trafficking process. Binds to ubiquitinated cargo proteins and is required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies (MVBs). Mediates the association between the ESCRT-0 and ESCRT-I complex. Required for completion of cytokinesis; the function requires CEP55. May be involved in cell growth and differentiation. Acts as a negative growth regulator. Involved in the budding of many viruses through an interaction with viral proteins that contain a late-budding motif P-[ST]-A-P. This interaction is essential for viral particle budding of numerous retroviruses. Belongs to the ubiquitin-conjugating enzyme family. UEV subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Nuclear receptor co-regulator; Cell cycle regulation

Chromosomal Location of Human Ortholog: 11p15

Cellular Component: multivesicular body; late endosome membrane; early endosome; cytoplasm; late endosome; plasma membrane; nucleolus; endosome membrane

Molecular Function: ubiquitin binding; protein binding; protein homodimerization activity; DNA binding; ubiquitin protein ligase binding; transcription corepressor activity; calcium-dependent protein binding

Biological Process: viral reproduction; ubiquitin-dependent protein catabolic process via the multivesicular body pathway; non-lytic virus budding; protein modification process; viral infectious cycle; virus assembly; endosome transport; keratinocyte differentiation; negative regulation of cell proliferation; protein transport; cell division; viral protein processing; regulation of cell growth; cell cycle arrest; negative regulation of transcription, DNA-dependent

Disease: Breast Cancer