Capsid protein VP23 (26) Recombinant Protein | AlHV1gp23 recombinant protein
Recombinant Alcelaphine herpesvirus 1 Capsid protein VP23 (26)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Capsid protein VP23 (26); Recombinant Alcelaphine herpesvirus 1 Capsid protein VP23 (26); AlHV1gp23 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-306, Full length protein
Sequence
MAVDSKIVVSCTSRLFTDEVCKLQEKVGCIVPLRDSHGSQNLQTVGLKPALGIDLGSDYVLMCNYLSTCTLAILEEVTTDSLVLTKISRNGTYQIKNKYHPFFQWDSNIQVCVMPPLFDQESNSVDLQSNNFTLLLPIVVPCEVAHEALQKVLTYNIYLRVTQAEPNAARMADVLAQTNYVTYLGNHYSLNLEGMESLGALAFLDNLATYLCIMVGLLPRACVRLLTTLLRHGENELLNVFRRMIPDEFNAAAANLNADTVYPDMTKIGLLITYLQTLGSIFNLSPRLQVSTYTPENLSATCWYVC
Sequence Length
306
Species
Alcelaphine herpesvirus 1 (strain C500) (AIHV-1) (Malignant catarrhal fever virus)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34,095 Da
NCBI Official Full Name
minor capsid protein
NCBI Official Symbol
AlHV1gp23
NCBI Protein Information
ORF26; similar to EBV BDLF1, CMV UL85, HSV UL18
UniProt Protein Name
Triplex capsid protein 2
UniProt Gene Name
TRX2
Uniprot Description
Structural component of the T=16 icosahedral capsid. The capsid is composed of pentamers and hexamers of major capsid protein/MCP, which are linked together by heterotrimers called triplexes. These triplexes are formed by a single molecule of triplex protein 1/TRX1 and two copies of triplex protein 2/TRX2. Additionally, TRX1 is required for efficient transport of TRX2 to the nucleus, which is the site of capsid assembly.
Similar Products
Product Notes
The AlHV1gp23 trx2 (Catalog #AAA1051629) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-306, Full length protein. The amino acid sequence is listed below: MAVDSKIVVS CTSRLFTDEV CKLQEKVGCI VPLRDSHGSQ NLQTVGLKPA LGIDLGSDYV LMCNYLSTCT LAILEEVTTD SLVLTKISRN GTYQIKNKYH PFFQWDSNIQ VCVMPPLFDQ ESNSVDLQSN NFTLLLPIVV PCEVAHEALQ KVLTYNIYLR VTQAEPNAAR MADVLAQTNY VTYLGNHYSL NLEGMESLGA LAFLDNLATY LCIMVGLLPR ACVRLLTTLL RHGENELLNV FRRMIPDEFN AAAANLNADT VYPDMTKIGL LITYLQTLGS IFNLSPRLQV STYTPENLSA TCWYVC. It is sometimes possible for the material contained within the vial of "Capsid protein VP23 (26), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
