Triplex capsid protein 62 (62) Recombinant Protein | ORF62 recombinant protein
Recombinant Equine herpesvirus 2 Triplex capsid protein 62 (62)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Triplex capsid protein 62 (62); Recombinant Equine herpesvirus 2 Triplex capsid protein 62 (62); ORF62 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-338, Full length protein
Sequence
MKTKEVTPRGDSGEKLARDLLRLVPPQTHKLGTFRASELGRDLRAIVANYAPKTISGHIQIFRDDFIAPPYRQPLYGEFLVHAKTFHPQEPRGTFVFAFSVGDGPECTSVDTIFSPVSLFRVCGLGADAAPHTHRISHIWYESESDFLNVAANVRELIENCSLHKFLSPVGPLVQNIQSTFLNKITTVVKGEVLSNRSPPENIKLVLPSDLFFDMDETCPYPPSGDPVKPRVCYYVCILYVMVNNIPSASLQFFRTGKGASDVVFFLRRYYSDAIANKITVLGDNLDINNLTLGAVCMLGYSSSQSTPGRGNLHFRSYSLPTVEVSDFVAQPGSWTLI
Sequence Length
338
Species
Equine herpesvirus 2 (strain 86/87) (EHV-2)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37,509 Da
NCBI Official Full Name
capsid triplex subunit 1
NCBI Official Symbol
ORF62
NCBI Protein Information
complexed 1:2 with capsid triplex subunit 2 to connect capsid hexons and pentons; involved in capsid morphogenesis
UniProt Protein Name
Triplex capsid protein 1
UniProt Gene Name
TRX1
Uniprot Description
Structural component of the T=16 icosahedral capsid. The capsid is composed of pentamers and hexamers of major capsid protein/MCP, which are linked together by heterotrimers called triplexes. These triplexes are formed by a single molecule of triplex protein 1/TRX1 and two copies of triplex protein 2/TRX2. Additionally, TRX1 is required for efficient transport of TRX2 to the nucleus, which is the site of capsid assembly.
Similar Products
Product Notes
The ORF62 trx1 (Catalog #AAA1373492) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-338, Full length protein. The amino acid sequence is listed below: MKTKEVTPRG DSGEKLARDL LRLVPPQTHK LGTFRASELG RDLRAIVANY APKTISGHIQ IFRDDFIAPP YRQPLYGEFL VHAKTFHPQE PRGTFVFAFS VGDGPECTSV DTIFSPVSLF RVCGLGADAA PHTHRISHIW YESESDFLNV AANVRELIEN CSLHKFLSPV GPLVQNIQST FLNKITTVVK GEVLSNRSPP ENIKLVLPSD LFFDMDETCP YPPSGDPVKP RVCYYVCILY VMVNNIPSAS LQFFRTGKGA SDVVFFLRRY YSDAIANKIT VLGDNLDINN LTLGAVCMLG YSSSQSTPGR GNLHFRSYSL PTVEVSDFVA QPGSWTLI. It is sometimes possible for the material contained within the vial of "Triplex capsid protein 62 (62), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
