tRNA (adenine (58)-N (1))-methyltransferase catalytic subunit TRMT61A (Trmt61a) Recombinant Protein | Trmt61a recombinant protein
Recombinant Rat tRNA (adenine (58)-N (1))-methyltransferase catalytic subunit TRMT61A (Trmt61a)
Gene Names
Trmt61a; Gcd14; Trm61; RGD1359191
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
tRNA (adenine (58)-N (1))-methyltransferase catalytic subunit TRMT61A (Trmt61a); Recombinant Rat tRNA (adenine (58)-N (1))-methyltransferase catalytic subunit TRMT61A (Trmt61a); Trmt61a recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-290, full length protein
Sequence
MSFVAYEELIKEGDTAILSLGHGSMVAVRVQRGAQTQTRHGVLRHSVDLIGRPFGSKVTCSRGGWVYVLHPTPELWTVNLPHRTQILYSTDIALITMMLELRPGSVVCESGTGSGSVSHAIIRSIAPTGHLHTVEFHQQRADKAREEFQQHRVSQWVTVHTQDVCRSGFGVVHVADAVFLDIPSPWEAVGHAWDALKVEGGRFCSFSPCIEQVQRTCQALAAHGFTELSTLEVLPQVYNVRTVSLPLPDLGADDLEGNVGSDATPFRSGTPMKETVGHTGYLTFATKTPG
Sequence Length
290
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31,619 Da
NCBI Official Full Name
tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRMT61A
NCBI Official Synonym Full Names
tRNA methyltransferase 61A
NCBI Official Symbol
Trmt61a
NCBI Official Synonym Symbols
Gcd14; Trm61; RGD1359191
NCBI Protein Information
tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRMT61A
UniProt Protein Name
tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRMT61A
Protein Family
UniProt Gene Name
Trmt61a
UniProt Synonym Gene Names
Trm61; tRNA(m1A58)MTase subunit TRMT61A
Uniprot Description
Catalytic subunit of tRNA (adenine-N1-)-methyltransferase, which catalyzes the formation of N1-methyladenine at position 58 (m1A58) in initiator methionyl-tRNA. Catalytic subunit of mRNA N1-methyltransferase complex, which mediates methylation of adenosine residues at the N1 position of a small subset of mRNAs: N1 methylation takes place in tRNA T-loop-like structures of mRNAs and is only present at low stoichiometries.
Similar Products
Product Notes
The Trmt61a trmt61a (Catalog #AAA1418721) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-290, full length protein. The amino acid sequence is listed below: MSFVAYEELI KEGDTAILSL GHGSMVAVRV QRGAQTQTRH GVLRHSVDLI GRPFGSKVTC SRGGWVYVLH PTPELWTVNL PHRTQILYST DIALITMMLE LRPGSVVCES GTGSGSVSHA IIRSIAPTGH LHTVEFHQQR ADKAREEFQQ HRVSQWVTVH TQDVCRSGFG VVHVADAVFL DIPSPWEAVG HAWDALKVEG GRFCSFSPCI EQVQRTCQAL AAHGFTELST LEVLPQVYNV RTVSLPLPDL GADDLEGNVG SDATPFRSGT PMKETVGHTG YLTFATKTPG. It is sometimes possible for the material contained within the vial of "tRNA (adenine (58)-N (1))-methyltransferase catalytic subunit TRMT61A (Trmt61a), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
