Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Tripartite motif-containing protein 5 (TRIM5) Recombinant Protein | TRIM5 recombinant protein

Recombinant Pongo abelii Tripartite motif-containing protein 5 (TRIM5)

Gene Names
TRIM5; TRIM5alpha
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Tripartite motif-containing protein 5 (TRIM5); Recombinant Pongo abelii Tripartite motif-containing protein 5 (TRIM5); TRIM5 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-493, Full length protein
Sequence
MASGILVNVKEEVTCPICLELLTQPLSLDCGHSFCQACLTANHKKSTLDKGERSCPVCRVSYQPKNIRPNRHVANIVEKLREVKLSPEGQKVDHCARHGEKLLLFCKEDGKVICWLCERSQEHRGHHTFLTEEVAQKYQVKLQAALEMLRQKQQEAEELEADIREEKASWKTQIQYDKTSVLADFEQLRDILDWEESNELQNLEKEEEDILKSLTKSETEMVQQTQSVRELISDVEHRLQGSVMELLQGVDGIIKRMQNVTLKKPETFPKNQRRVFRAPNLKGMLEVFRELTDVRRYWVDVTVAPNDISYAVISEDMRQVSCPEPQITYGAQGTTYQTYVNFNYCTGILGSQSITSGKHYWEVNVSKKSAWILGVCAGFQPDAMYNIEQNENYQPQYGYWVIGLEEGVKCSAFQDGSFHNPSAPFIVPLSVIICPDRVGVFLDYEACTVSFFNITNHGFLIYKFSHCSFSQPVFPYLNPRKCRVPMTLCSPSS
Sequence Length
493
Species
Pongo abelii (Sumatran orangutan)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56,435 Da
NCBI Official Full Name
tripartite motif-containing protein 5
NCBI Official Symbol
TRIM5
NCBI Official Synonym Symbols
TRIM5alpha
NCBI Protein Information
tripartite motif-containing protein 5
UniProt Protein Name
Tripartite motif-containing protein 5
UniProt Gene Name
TRIM5

Uniprot Description

Capsid-specific restriction factor that prevents infection from non-host-adapted retroviruses. Blocks viral replication early in the life cycle, after viral entry but before reverse transcription. In addition to acting as a capsid-specific restriction factor, also acts as a pattern recognition receptor that activates innate immune signaling in response to the retroviral capsid lattice. Binding to the viral capsid triggers its E3 ubiquitin ligase activity, and in concert with the heterodimeric ubiquitin conjugating enzyme complex UBE2V1-UBE2N (also known as UBC13-UEV1A complex) generates 'Lys-63'-linked polyubiquitin chains, which in turn are catalysts in the autophosphorylation of the MAP3K7/TAK1 complex (includes TAK1, TAB2, and TAB3). Activation of the MAP3K7/TAK1 complex by autophosphorylation results in the induction and expression of NF-kappa-B and MAPK-responsive inflammatory genes, thereby leading to an innate immune response in the infected cell. Plays a role in regulating autophagy through activation of autophagy regulator BECN1 by causing its dissociation from its inhibitors BCL2 and TAB2.

Similar Products

Product Notes

The TRIM5 trim5 (Catalog #AAA1482478) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-493, Full length protein. The amino acid sequence is listed below: MASGILVNVK EEVTCPICLE LLTQPLSLDC GHSFCQACLT ANHKKSTLDK GERSCPVCRV SYQPKNIRPN RHVANIVEKL REVKLSPEGQ KVDHCARHGE KLLLFCKEDG KVICWLCERS QEHRGHHTFL TEEVAQKYQV KLQAALEMLR QKQQEAEELE ADIREEKASW KTQIQYDKTS VLADFEQLRD ILDWEESNEL QNLEKEEEDI LKSLTKSETE MVQQTQSVRE LISDVEHRLQ GSVMELLQGV DGIIKRMQNV TLKKPETFPK NQRRVFRAPN LKGMLEVFRE LTDVRRYWVD VTVAPNDISY AVISEDMRQV SCPEPQITYG AQGTTYQTYV NFNYCTGILG SQSITSGKHY WEVNVSKKSA WILGVCAGFQ PDAMYNIEQN ENYQPQYGYW VIGLEEGVKC SAFQDGSFHN PSAPFIVPLS VIICPDRVGV FLDYEACTVS FFNITNHGFL IYKFSHCSFS QPVFPYLNPR KCRVPMTLCS PSS. It is sometimes possible for the material contained within the vial of "Tripartite motif-containing protein 5 (TRIM5), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.