Transcription intermediary factor 1-alpha Recombinant Protein | TRIM24 recombinant protein

Recombinant Human Transcription intermediary factor 1-alpha

Cat. Num. AAA1147673

• Gene Names: TRIM24; PTC6; TF1A; TIF1; RNF82; TIF1A; hTIF1; TIF1ALPHA
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Transcription intermediary factor 1-alpha; Recombinant Human Transcription intermediary factor 1-alpha; E3 ubiquitin-protein ligase TRIM24; RING finger protein 82; Tripartite motif-containing protein 24; TRIM24 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 891-1012aa; Partial
• Sequence: KKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYPEKRFPK
• Sequence Length: 1016

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for TRIM24 recombinant protein

Transcriptional coactivator that interacts with numerous nuclear receptors and coactivators and modulates the transcription of target genes. Interacts with chromatin depending on histone H3 modifications, having the highest affinity for histone H3 that is both unmodified at 'Lys-4' (H3K4me0) and acetylated at 'Lys-23' (H3K23ac). Has E3 protein-ubiquitin ligase activity. Promotes ubiquitination and proteasomal degradation of p53/TP53. Plays a role in the regulation of cell proliferation and apoptosis, at least in part via its effects on p53/TP53 levels. Up-regulates ligand-dependent transcription activation by AR, GCR/NR3C1, thyroid hormone receptor (TR) and ESR1. Modulates transcription activation by retinoic acid (RA) receptors, including RARA. Plays a role in regulating retinoic acid-dependent proliferation of hepatocytes.

Product Categories/Family for TRIM24 recombinant protein

Epigenetics and Nuclear Signaling

References

Differential interaction of nuclear receptors with the putative human transcriptional coactivator hTIF1.Thenot S., Henriquet C., Rochefort H., Cavailles V.J. Biol. Chem. 272:12062-12068(1997) TIF1gamma, a novel member of the transcriptional intermediary factor 1 family.Venturini L., You J., Stadler M., Galien R., Lallemand V., Koken M.H.M., Mattei M.-G., Ganser A., Chambon P., Losson R., De The H.Oncogene 18:1209-1217(1999) Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) Human chromosome 7 DNA sequence and biology.Scherer S.W., Cheung J., MacDonald J.R., Osborne L.R., Nakabayashi K., Herbrick J.-A., Carson A.R., Parker-Katiraee L., Skaug J., Khaja R., Zhang J., Hudek A.K., Li M., Haddad M., Duggan G.E., Fernandez B.A., Kanematsu E., Gentles S., Christopoulos C.C., Choufani S., Kwasnicka D., Zheng X.H., Lai Z., Nusskern D.R., Zhang Q., Gu Z., Lu F., Zeesman S., Nowaczyk M.J., Teshima I., Chitayat D., Shuman C., Weksberg R., Zackai E.H., Grebe T.A., Cox S.R., Kirkpatrick S.J., Rahman N., Friedman J.M., Heng H.H.Q., Pelicci P.G., Lo-Coco F., Belloni E., Shaffer L.G., Pober B., Morton C.C., Gusella J.F., Bruns G.A.P., Korf B.R., Quade B.J., Ligon A.H., Ferguson H., Higgins A.W., Leach N.T., Herrick S.R., Lemyre E., Farra C.G., Kim H.-G., Summers A.M., Gripp K.W., Roberts W., Szatmari P., Winsor E.J.T., Grzeschik K.-H., Teebi A., Minassian B.A., Kere J., Armengol L., Pujana M.A., Estivill X., Wilson M.D., Koop B.F., Tosi S., Moore G.E., Boright A.P., Zlotorynski E., Kerem B., Kroisel P.M., Petek E., Oscier D.G., Mould S.J., Doehner H., Doehner K., Rommens J.M., Vincent J.B., Venter J.C., Li P.W., Mural R.J., Adams M.D., Tsui L.-C.Science 300:767-772(2003)

NCBI and Uniprot Product Information

• NCBI GI #: 47419909
• NCBI GeneID: 8805
• NCBI Accession #: NP_003843.3
• NCBI GenBank Nucleotide #: NM_003852.3
• UniProt Accession #: O15164; O95854; A4D1R7; A4D1R8
• Molecular Weight: 16.5 kDa
• NCBI Official Full Name: transcription intermediary factor 1-alpha isoform b
• NCBI Official Synonym Full Names: tripartite motif containing 24
• NCBI Official Symbol: TRIM24
• NCBI Official Synonym Symbols: PTC6; TF1A; TIF1; RNF82; TIF1A; hTIF1; TIF1ALPHA
• NCBI Protein Information: transcription intermediary factor 1-alpha
• UniProt Protein Name: Transcription intermediary factor 1-alpha
• Protein Family: Transcription intermediary factor
• UniProt Gene Name: TRIM24
• UniProt Synonym Gene Names: RNF82; TIF1; TIF1A; TIF1-alpha
• UniProt Entry Name: TIF1A_HUMAN

NCBI Description

The protein encoded by this gene mediates transcriptional control by interaction with the activation function 2 (AF2) region of several nuclear receptors, including the estrogen, retinoic acid, and vitamin D3 receptors. The protein localizes to nuclear bodies and is thought to associate with chromatin and heterochromatin-associated factors. The protein is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains - a RING, a B-box type 1 and a B-box type 2 - and a coiled-coil region. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

TRIM24: an atypical protein kinase that functions as a transcriptional coactivator. Originally identified as a mammalian protein that enhances the AF-2 activity of the retinoid X receptor (RXR) in a yeast genetic screen. Binds to nuclear receptors in an agonist and AF2-activating domain (AF2-AD) dependent manner. Binding to the agonist-nuclear receptor complex induces its own hyperphosphorylation as well as the phosphorylation of TFIIEa, TAFII28, and TAFII55. Belongs to a family of nuclear proteins that includes TIF1b and TIF1g. TIF1 proteins are characterized by an N-terminal region that contains a RING finger-B boxes-coiled coil (RBCC) motif, a poorly conserved central region, a C-terminal region that contains a PHD finger, and a bromodomain. Interacts with the heterochromatin-associated proteins HP1a, MOD1 (HP1b), and MOD2 (HP1g) and with the transcriptional repression domain KRAB, which is present in many Kruppel-type (C2H2) zinc finger proteins. May act as a repressor through the formation of transcriptionally inactive heterochromatin. Two splice variant isoforms have been described.

Protein type: Ubiquitin conjugating system; Tumor suppressor; Transcription, coactivator/corepressor; Kinase, protein; EC 6.3.2.-; Nuclear receptor co-regulator; Protein kinase, atypical; ATYPICAL group; TIF1 family

Chromosomal Location of Human Ortholog: 7q32-q34

Cellular Component: cytosol; nucleus; perichromatin fibrils

Molecular Function: chromatin binding; estrogen response element binding; ligand-dependent nuclear receptor binding; ligase activity; methylated histone residue binding; p53 binding; protein binding; protein kinase activity; receptor binding; sequence-specific DNA binding; transcription coactivator activity; ubiquitin-protein ligase activity; zinc ion binding

Biological Process: calcium ion homeostasis; negative regulation of cell proliferation; negative regulation of transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; protein amino acid autophosphorylation; protein catabolic process; protein ubiquitination; regulation of apoptosis; regulation of protein stability; transcription from RNA polymerase II promoter

Disease: Thyroid Carcinoma, Papillary