Putative tyrosine-protein phosphatase TPTE (TPTE) Recombinant Protein | TPTE recombinant protein
Recombinant Human Putative tyrosine-protein phosphatase TPTE (TPTE)
Gene Names
TPTE; CT44; PTEN2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Putative tyrosine-protein phosphatase TPTE (TPTE); Recombinant Human Putative tyrosine-protein phosphatase TPTE (TPTE); TPTE recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-551aa; Full length protein
Sequence
MNESPDPTDLAGVIIELGPNDSPQTSEFKGATEEAPAKESPHTSEFKGAARVSPISESVL ARLSKFEVEDAENVASYDSKIKKIVHSIVSSFAFGLFGVFLVLLDVTLILADLIFTDSKL YIPLEYRSISLAIALFFLMDVLLRVFVERRQQYFSDLFNILDTAIIVILLLVDVVYIFFD IKLLRNIPRWTHLLRLLRLIILLRIFHLFHQKRQLEKLIRRRVSENKRRYTRDGFDLDLT YVTERIIAMSFPSSGRQSFYRNPIKEVVRFLDKKHRNHYRVYNLCSERAYDPKHFHNRVV RIMIDDHNVPTLHQMVVFTKEVNEWMAQDLENIVAIHCKGGTDRTGTMVCAFLIASEICS TAKESLYYFGERRTDKTHSEKFQGVKTPSQKRYVAYFAQVKHLYNWNLPPRRILFIKHFI IYSIPRYVRDLKIQIEMEKKVVFSTISLGKCSVLDNITTDKILIDVFDGLPLYDDVKVQF FYSNLPTYYDNCSFYFWLHTSFIENNRLYLPKNELDNLHKQKARRIYPSDFAVEILFGEK MTSSDVVAGSD
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for TPTE recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
49,344 Da
NCBI Official Full Name
putative tyrosine-protein phosphatase TPTE isoform delta
NCBI Official Synonym Full Names
transmembrane phosphatase with tensin homology
NCBI Official Symbol
TPTE
NCBI Official Synonym Symbols
CT44; PTEN2
NCBI Protein Information
putative tyrosine-protein phosphatase TPTE
UniProt Protein Name
Putative tyrosine-protein phosphatase TPTE
Protein Family
UniProt Gene Name
TPTE
UniProt Synonym Gene Names
CT44
UniProt Entry Name
TPTE_HUMAN
NCBI Description
This gene encodes a PTEN-related tyrosine phosphatase which may play a role in the signal transduction pathways of the endocrine or spermatogenic function of the testis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2014]
Uniprot Description
TPTE: Could be involved in signal transduction. 4 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, multi-pass; Membrane protein, integral; Receptor protein phosphatase, tyrosine; Motility/polarity/chemotaxis; EC 3.1.3.48; Cancer Testis Antigen (CTA)
Chromosomal Location of Human Ortholog: 21p11
Cellular Component: integral to membrane
Molecular Function: protein tyrosine phosphatase activity; protein tyrosine/serine/threonine phosphatase activity
Biological Process: protein amino acid dephosphorylation; signal transduction
Research Articles on TPTE
Similar Products
Product Notes
The TPTE tpte (Catalog #AAA7032128) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-551aa; Full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the TPTE tpte for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MNESPDPTDL AGVIIELGPN DSPQTSEFKG ATEEAPAKES PHTSEFKGAA RVSPISESVL ARLSKFEVED AENVASYDSK IKKIVHSIVS SFAFGLFGVF LVLLDVTLIL ADLIFTDSKL YIPLEYRSIS LAIALFFLMD VLLRVFVERR QQYFSDLFNI LDTAIIVILL LVDVVYIFFD IKLLRNIPRW THLLRLLRLI ILLRIFHLFH QKRQLEKLIR RRVSENKRRY TRDGFDLDLT YVTERIIAMS FPSSGRQSFY RNPIKEVVRF LDKKHRNHYR VYNLCSERAY DPKHFHNRVV RIMIDDHNVP TLHQMVVFTK EVNEWMAQDL ENIVAIHCKG GTDRTGTMVC AFLIASEICS TAKESLYYFG ERRTDKTHSE KFQGVKTPSQ KRYVAYFAQV KHLYNWNLPP RRILFIKHFI IYSIPRYVRD LKIQIEMEKK VVFSTISLGK CSVLDNITTD KILIDVFDGL PLYDDVKVQF FYSNLPTYYD NCSFYFWLHT SFIENNRLYL PKNELDNLHK QKARRIYPSD FAVEILFGEK MTSSDVVAGS D. It is sometimes possible for the material contained within the vial of "Putative tyrosine-protein phosphatase TPTE (TPTE), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
