Thyroid peroxidase (TPO) Recombinant Protein | TPO recombinant protein
Recombinant Dog Thyroid peroxidase (TPO), partial
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Thyroid peroxidase (TPO); Recombinant Dog Thyroid peroxidase (TPO); partial; TPO recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
673-856; Partial
Sequence
RDGDRFWWESSGVFTDEQRRELARHSLSRVICDNTGLPSVPADAFQVSRFPQDFEPCENIPGLNLDVWREALPQGDACGLPDSLDNGDVVLCGEAGRRVLVFSCRHGFKLQGPEQVACSPRGGAVRAPVCRDINECEDASHPPCHGSARCRNTKGGFRCECTDPAVLGEDGTTCVDSGRLPKAS
Sequence Length
856
Species
Canis familiaris (Dog) (Canis lupus familiaris)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for TPO recombinant protein
This gene encodes a membrane-bound glycoprotein. The encoded protein acts as an enzyme and plays a central role in thyroid gland function. The protein functions in the iodination of tyrosine residues in thyroglobulin and phenoxy-ester formation between pairs of iodinated tyrosines to generate the thyroid hormones, thyroxine and triiodothyronine. Mutations in this gene are associated with several disorders of thyroid hormonogenesis, including congenital hypothyroidism, congenital goiter, and thyroid hormone organification defect IIA. Multiple transcript variants encoding distinct isoforms have been identified for this gene. Additional splice variants have been described but their biological natures have not been determined.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
101,406 Da
NCBI Official Full Name
thyroid peroxidase
NCBI Official Synonym Full Names
thyroid peroxidase
NCBI Official Symbol
TPO
NCBI Protein Information
thyroid peroxidase
UniProt Protein Name
Thyroid peroxidase
Protein Family
UniProt Gene Name
TPO
UniProt Synonym Gene Names
TPO
Uniprot Description
Iodination and coupling of the hormonogenic tyrosines in thyroglobulin to yield the thyroid hormones T3 and T4.
Research Articles on TPO
Similar Products
Product Notes
The TPO tpo (Catalog #AAA1401037) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 673-856; Partial. The amino acid sequence is listed below: RDGDRFWWES SGVFTDEQRR ELARHSLSRV ICDNTGLPSV PADAFQVSRF PQDFEPCENI PGLNLDVWRE ALPQGDACGL PDSLDNGDVV LCGEAGRRVL VFSCRHGFKL QGPEQVACSP RGGAVRAPVC RDINECEDAS HPPCHGSARC RNTKGGFRCE CTDPAVLGED GTTCVDSGRL PKAS . It is sometimes possible for the material contained within the vial of "Thyroid peroxidase (TPO), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
