Two pore potassium channel c (TPKC) Recombinant Protein | TPKC recombinant protein
Recombinant Oryza sativa subsp. japonica Two pore potassium channel c (TPKC)
Gene Names
LOC4346662; KCO3; TPKC; OsKCO3; OsJ_28764
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Two pore potassium channel c (TPKC); Recombinant Oryza sativa subsp. japonica Two pore potassium channel c (TPKC); TPKC recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-456aa; full length protein
Sequence
MDTEPLLSPLSPSPHLLHPLPEHAEVSTFSPPLSPCPSPASSYKERIIFGAHPPPPPPPP PPPPPPPRGRRYYRRVSGDDLDVPSCSSSPSPPSDEENPPPNPPSLFDFIGGRTNLHRSR TAPAMAPLNAAAIAAAAASGDSRNPPPPPRRPAIVLHAFLFLLAYLAMGVTFYAALPGNF TSSAGPTHPVADALYFCIVTLCTIGYGDITPATPAAKLFSISFVLIGFGFVDILLSGMVS YVLDLQEHLLITALKNPRSVRKHRHNYIFDLKKGRMRVRMKVALALTVVAICVGVGAAVL KRVENLGWLDAVYLAVMSVTTVGYGDHAFRTLAGRLFASAWLLVSTLAVARAFLYLAEMR IDKRHRAMANWVLSRDMTVSEFLAADIDNNGYVTKSEFVVYKLKEMGKISEKDIMMICDQ FQRMDSGNCGKITLSDLLESHQLVTDLNEKKKGKKS
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Oryza sativa subsp. japonica (Rice)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for TPKC recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49,658 Da
NCBI Official Full Name
two pore potassium channel c
NCBI Official Symbol
LOC4346662
NCBI Official Synonym Symbols
KCO3; TPKC; OsKCO3; OsJ_28764
NCBI Protein Information
two pore potassium channel c; Calcium-activated outward-rectifying potassium channel 3; LOC_Os09g12790; OSJNBa0062A09.6; Os09g0299400; Two K(+) channel c; putative outward-rectifying potassium channel KCO1
UniProt Protein Name
Two pore potassium channel c
Protein Family
UniProt Gene Name
TPKC
UniProt Synonym Gene Names
KCO3; Two K(+) channel c; OsKCO3
UniProt Entry Name
KCO3_ORYSJ
Uniprot Description
Inward-rectifying potassium channel.
Similar Products
Product Notes
The TPKC tpkc (Catalog #AAA7032115) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-456aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the TPKC tpkc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MDTEPLLSPL SPSPHLLHPL PEHAEVSTFS PPLSPCPSPA SSYKERIIFG AHPPPPPPPP PPPPPPPRGR RYYRRVSGDD LDVPSCSSSP SPPSDEENPP PNPPSLFDFI GGRTNLHRSR TAPAMAPLNA AAIAAAAASG DSRNPPPPPR RPAIVLHAFL FLLAYLAMGV TFYAALPGNF TSSAGPTHPV ADALYFCIVT LCTIGYGDIT PATPAAKLFS ISFVLIGFGF VDILLSGMVS YVLDLQEHLL ITALKNPRSV RKHRHNYIFD LKKGRMRVRM KVALALTVVA ICVGVGAAVL KRVENLGWLD AVYLAVMSVT TVGYGDHAFR TLAGRLFASA WLLVSTLAVA RAFLYLAEMR IDKRHRAMAN WVLSRDMTVS EFLAADIDNN GYVTKSEFVV YKLKEMGKIS EKDIMMICDQ FQRMDSGNCG KITLSDLLES HQLVTDLNEK KKGKKS. It is sometimes possible for the material contained within the vial of "Two pore potassium channel c (TPKC), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
