Probable calcium-activated outward-rectifying potassium channel 6 (KCO6) Recombinant Protein | KCO6 recombinant protein
Recombinant Arabidopsis thaliana Probable calcium-activated outward-rectifying potassium channel 6 (KCO6)
Gene Names
KCO6; ATKCO6; ATTPK3; Ca2+ activated outward rectifying K+ channel 6; CA2+ ACTIVATED OUTWARD RECTIFYING K+ CHANNEL 6; F15J5.130; F15J5_130; KCO6; TPK3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable calcium-activated outward-rectifying potassium channel 6 (KCO6); Recombinant Arabidopsis thaliana Probable calcium-activated outward-rectifying potassium channel 6 (KCO6); KCO6 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-436aa; full length protein
Sequence
MANEGSDPLLQYMISPRLKKPPQLLFPLPEDNEVAIPMPMTPSEFKERLIFGPFSCSPRD SSHFIDSMKQPSPSSSSTAVNNPFSDSSTLDPLLPPPPPQPEPWLSDQTSSHCQGHALHR SKTAPAMAVINDLHHPIRQKDPTETSRSVVRQAFALLVVYLSLGVLIYWLNRDHYVVNQT HPVVDGLYFCIVTMCTIGYGDITPNSVVTKLFSIMFVLVGFGFIDILLSGMVSYVLDLQE SYMLDSAKRRDEPEKRRSYIIDVKKGRMRIRLKVALALGVVVLCIAVGVGIMHFIEEIGW LDSFYLSVMSVTTVGYGDRAFKTLPGRLFAAIWLLVSTLAVARAFLYLAEARVDKRNRER AKKVLCETMSVSQFFAADIDNNGCVSKAEYVIYKLKEMEKITDKDILPISKQFDKLDRCS NGKITLLDLLEGGSGD
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for KCO6 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48,732 Da
NCBI Official Full Name
protein two-pore potassium channel 3
NCBI Official Symbol
KCO6
NCBI Official Synonym Symbols
ATKCO6; ATTPK3; Ca2+ activated outward rectifying K+ channel 6; CA2+ ACTIVATED OUTWARD RECTIFYING K+ CHANNEL 6; F15J5.130; F15J5_130; KCO6; TPK3
NCBI Protein Information
protein two-pore potassium channel 3
UniProt Protein Name
Two-pore potassium channel 3
UniProt Gene Name
TPK3
UniProt Synonym Gene Names
KCO6; AtTPK3; AtKCO6
UniProt Entry Name
KCO6_ARATH
NCBI Description
Encodes AtTPK3 (KCO6), a member of the Arabidopsis thaliana K+ channel family of AtTPK/KCO proteins.AtTPK3 is targeted to the vacuolar membrane. May form homomeric ion channels in vivo.
Uniprot Description
Two-pore potassium channel modulating the proton motive force (pmf) necessary to convert photochemical energy into physiological functions. Mediates the potassium efflux from the thylakoid lumen required for the regulation of the transmembrane electrical potential, the enhancement of the pH gradient for ATP synthesis, the regulation of electron flow, and pH-mediated photoprotective responses. Requires calcium for channel activity.
Research Articles on KCO6
Similar Products
Product Notes
The KCO6 tpk3 (Catalog #AAA7017815) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-436aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the KCO6 tpk3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MANEGSDPLL QYMISPRLKK PPQLLFPLPE DNEVAIPMPM TPSEFKERLI FGPFSCSPRD SSHFIDSMKQ PSPSSSSTAV NNPFSDSSTL DPLLPPPPPQ PEPWLSDQTS SHCQGHALHR SKTAPAMAVI NDLHHPIRQK DPTETSRSVV RQAFALLVVY LSLGVLIYWL NRDHYVVNQT HPVVDGLYFC IVTMCTIGYG DITPNSVVTK LFSIMFVLVG FGFIDILLSG MVSYVLDLQE SYMLDSAKRR DEPEKRRSYI IDVKKGRMRI RLKVALALGV VVLCIAVGVG IMHFIEEIGW LDSFYLSVMS VTTVGYGDRA FKTLPGRLFA AIWLLVSTLA VARAFLYLAE ARVDKRNRER AKKVLCETMS VSQFFAADID NNGCVSKAEY VIYKLKEMEK ITDKDILPIS KQFDKLDRCS NGKITLLDLL EGGSGD. It is sometimes possible for the material contained within the vial of "Probable calcium-activated outward-rectifying potassium channel 6 (KCO6), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
