Mitochondrial import receptor subunit TOM22 homolog Recombinant Protein | TOMM22 recombinant protein
Mitochondrial import receptor subunit TOM22 homolog
Gene Names
TOMM22; Tom22
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Mitochondrial import receptor subunit TOM22 homolog; TOMM22 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-140aa; full length protein
Sequence
MAAAAAGPGAPLSADELLPKGDAEKPEEELEEEDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQILLGPNTGLSGGMPGALPSLPGKI
Sequence Length
140
Species
Bos taurus (Bovine)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for TOMM22 recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for TOMM22 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15,292 Da
NCBI Official Full Name
mitochondrial import receptor subunit TOM22 homolog
NCBI Official Symbol
TOMM22
NCBI Official Synonym Symbols
Tom22
NCBI Protein Information
mitochondrial import receptor subunit TOM22 homolog
UniProt Protein Name
Mitochondrial import receptor subunit TOM22 homolog
Protein Family
UniProt Gene Name
TOMM22
UniProt Entry Name
TOM22_BOVIN
Uniprot Description
Central receptor component of the translocase of the outer membrane of mitochondria (TOM complex) responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. Together with the peripheral receptor TOM20 functions as the transit peptide receptor and facilitates the movement of preproteins into the translocation pore.
Research Articles on TOMM22
Similar Products
Product Notes
The TOMM22 tomm22 (Catalog #AAA7043510) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-140aa; full length protein. The amino acid sequence is listed below: MAAAAAGPGA PLSADELLPK GDAEKPEEEL EEEDDEELDE TLSERLWGLT EMFPERVRSA AGATFDLSLF VAQKMYRFSR AALWIGTTSF MILVLPVVFE TEKLQMEQQQ QLQQRQILLG PNTGLSGGMP GALPSLPGKI. It is sometimes possible for the material contained within the vial of "Mitochondrial import receptor subunit TOM22 homolog, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
