Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using LDB1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

Rabbit LDB1 Polyclonal Antibody | anti-LDB1 antibody

LDB1 Rabbit pAb

Gene Names
LDB1; NLI; CLIM2
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity purification
Synonyms
LDB1; Polyclonal Antibody; LDB1 Rabbit pAb; CLIM-2; CLIM2; LDB-1; NLI; anti-LDB1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MLDRDVGPTPMYPPTYLEPGIGRHTPYGNQTDYRIFELNKRLQNWTEECD
Applicable Applications for anti-LDB1 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
WB: 1:500-1:2000
IHC: 1:50-1:100
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-50 of human LDB1 (NP_003884.1).
Positive Samples
Mouse brain, Rat brain
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using LDB1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using LDB1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded human uterine cancer using LDB1 antibody at dilution of 1:200 (40x lens).)

Immunohistochemistry (IHC) (Immunohistochemistry of paraffin-embedded human uterine cancer using LDB1 antibody at dilution of 1:200 (40x lens).)

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded human tonsil using LDB1 antibody at dilution of 1:200 (40x lens).)

Immunohistochemistry (IHC) (Immunohistochemistry of paraffin-embedded human tonsil using LDB1 antibody at dilution of 1:200 (40x lens).)

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded human colon using LDB1 antibody at dilution of 1:200 (40x lens).)

Immunohistochemistry (IHC) (Immunohistochemistry of paraffin-embedded human colon using LDB1 antibody at dilution of 1:200 (40x lens).)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46,533 Da
NCBI Official Full Name
LIM domain-binding protein 1 isoform 1
NCBI Official Synonym Full Names
LIM domain binding 1
NCBI Official Symbol
LDB1
NCBI Official Synonym Symbols
NLI; CLIM2
NCBI Protein Information
LIM domain-binding protein 1; LDB-1; hLdb1; CLIM-2; nuclear LIM interactor; LIM domain-binding factor-1; LIM domain-binding factor CLIM2; carboxy terminal LIM domain protein 2; carboxyl-terminal LIM domain-binding protein 2
UniProt Protein Name
LIM domain-binding protein 1
UniProt Gene Name
LDB1
UniProt Synonym Gene Names
CLIM2; LDB-1; CLIM-2; hLdb1
UniProt Entry Name
LDB1_HUMAN

Uniprot Description

LDB1: Binds to the LIM domain of a wide variety of LIM domain- containing transcription factors. May regulate the transcriptional activity of LIM-containing proteins by determining specific partner interactions. May play a role in the development of motor neurons. Acts synergistically with LHX1/LIM1 in axis formation and activation of gene expression. Acts with LMO2 in the regulation of red blood cell development, maintaining erythroid precursors in an immature state. Belongs to the LDB family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 10q24-q25

Cellular Component: transcription factor complex; protein complex; nuclear chromatin; nucleus

Molecular Function: LIM domain binding; enzyme binding; protein homodimerization activity; protein self-association; chromatin binding; transcription corepressor activity

Biological Process: transcription from RNA polymerase II promoter; negative regulation of erythrocyte differentiation; positive regulation of cell adhesion; Wnt receptor signaling pathway; transcription, DNA-dependent; somatic stem cell maintenance; multicellular organismal development; gastrulation with mouth forming second; positive regulation of hemoglobin biosynthetic process; cellular component assembly; neuron differentiation; regulation of transcription, DNA-dependent; hair follicle development; cerebellar Purkinje cell differentiation; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; regulation of RNA elongation; anterior/posterior axis specification

Research Articles on LDB1

Similar Products

Product Notes

The LDB1 ldb1 (Catalog #AAA9142853) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LDB1 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's LDB1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). WB: 1:500-1:2000 IHC: 1:50-1:100. Researchers should empirically determine the suitability of the LDB1 ldb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MLDRDVGPTP MYPPTYLEPG IGRHTPYGNQ TDYRIFELNK RLQNWTEECD. It is sometimes possible for the material contained within the vial of "LDB1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.