Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Tankyrase-2 (Tnks2) Recombinant Protein | Tnks2 recombinant protein

Recombinant Mouse Tankyrase-2 (Tnks2) , partial

Gene Names
Tnks2; ARTD6; Tank2; TNKS-2; AA517131; AI662480; 5430432P15Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Tankyrase-2 (Tnks2); Recombinant Mouse Tankyrase-2 (Tnks2); partial; Tnks2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
873-1164. Partial, including the SAM domain and PARP catalytic domain
Sequence
GIDFSITQFIRNLGLEHLMDIFEREQITLDVLVEMGHKELKEIGINAYGHRHKLIKGVERLISGQQGLNPYLTLNNSGSGTILIDLSPDDKEFQSVEEEMQSTVREHRDGGHAGGVFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPIHKDRSCYICHRQLLFCRVTLGKSFLQFSAMKMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIVRPEGMV
Sequence Length
1164
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
126,744 Da
NCBI Official Full Name
tankyrase-2
NCBI Official Synonym Full Names
tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase 2
NCBI Official Symbol
Tnks2
NCBI Official Synonym Symbols
ARTD6; Tank2; TNKS-2; AA517131; AI662480; 5430432P15Rik
NCBI Protein Information
tankyrase-2
UniProt Protein Name
Tankyrase-2
Protein Family
UniProt Gene Name
Tnks2
UniProt Synonym Gene Names
Tank2; TANK2; ARTD6

Uniprot Description

Poly-ADP-ribosyltransferase involved in various processes such as Wnt signaling pathway, telomere length and vesicle trafficking. Acts as an activator of the Wnt signaling pathway by mediating poly-ADP-ribosylation of AXIN1 and AXIN2, 2 key components of the beta-catenin destruction complex: poly-ADP-ribosylated target proteins are recognized by RNF146, which mediates their ubiquitination and subsequent degradation. Also mediates poly-ADP-ribosylation of BLZF1 and CASC3, followed by recruitment of RNF146 and subsequent ubiquitination. Mediates poly-ADP-ribosylation of TERF1, thereby contributing to the regulation of telomere length. May also regulate vesicle trafficking and modulate the subcellular distribution of SLC2A4/GLUT4-vesicles. Stimulates 26S proteasome activity ().

Research Articles on Tnks2

Similar Products

Product Notes

The Tnks2 tnks2 (Catalog #AAA1371584) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 873-1164. Partial, including the SAM domain and PARP catalytic domain. The amino acid sequence is listed below: GIDFSITQFI RNLGLEHLMD IFEREQITLD VLVEMGHKEL KEIGINAYGH RHKLIKGVER LISGQQGLNP YLTLNNSGSG TILIDLSPDD KEFQSVEEEM QSTVREHRDG GHAGGVFNRY NILKIQKVCN KKLWERYTHR RKEVSEENHN HANERMLFHG SPFVNAIIHK GFDERHAYIG GMFGAGIYFA ENSSKSNQYV YGIGGGTGCP IHKDRSCYIC HRQLLFCRVT LGKSFLQFSA MKMAHSPPGH HSVTGRPSVN GLALAEYVIY RGEQAYPEYL ITYQIVRPEG MV . It is sometimes possible for the material contained within the vial of "Tankyrase-2 (Tnks2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.