Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-TRIM54 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: ACHN cell lysate)

Rabbit TRIM54 Polyclonal Antibody | anti-TRIM54 antibody

TRIM54 antibody - N-terminal region

Gene Names
TRIM54; MURF; RNF30; muRF3; MURF-3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TRIM54; Polyclonal Antibody; TRIM54 antibody - N-terminal region; anti-TRIM54 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IYKQESSRPLHSKAEQHLMCEEHEEEKINIYCLSCEVPTCSLCKVFGAHK
Sequence Length
400
Applicable Applications for anti-TRIM54 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TRIM54
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-TRIM54 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: ACHN cell lysate)

Western Blot (WB) (WB Suggested Anti-TRIM54 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: ACHN cell lysate)
Related Product Information for anti-TRIM54 antibody
This is a rabbit polyclonal antibody against TRIM54. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TRIM54 contains a RING finger motif and is highly similar to the ring finger proteins RNF28/MURF1 and RNF29/MURF2. In vitro studies demonstrated that this protein, RNF28, and RNF29 form heterodimers, which may be important for the regulation of titin kinase and microtubule-dependent signal pathways in striated muscles.
Product Categories/Family for anti-TRIM54 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
tripartite motif-containing protein 54 isoform 1
NCBI Official Synonym Full Names
tripartite motif containing 54
NCBI Official Symbol
TRIM54
NCBI Official Synonym Symbols
MURF; RNF30; muRF3; MURF-3
NCBI Protein Information
tripartite motif-containing protein 54
UniProt Protein Name
Tripartite motif-containing protein 54
UniProt Gene Name
TRIM54
UniProt Synonym Gene Names
MURF; MURF3; RNF30; MuRF; MuRF-3; MuRF3
UniProt Entry Name
TRI54_HUMAN

NCBI Description

The protein encoded by this gene contains a RING finger motif and is highly similar to the ring finger proteins RNF28/MURF1 and RNF29/MURF2. In vitro studies demonstrated that this protein, RNF28, and RNF29 form heterodimers, which may be important for the regulation of titin kinase and microtubule-dependent signal pathways in striated muscles. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]

Uniprot Description

TRIM54: May bind and stabilize microtubules during myotubes formation. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Ubiquitin ligase; Ligase; EC 6.3.2.-; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 2p23.3

Cellular Component: microtubule; microtubule associated complex; Z disc

Molecular Function: signal transducer activity; zinc ion binding; microtubule binding

Biological Process: negative regulation of microtubule depolymerization; multicellular organismal development; signal transduction; cell differentiation; microtubule-based process

Research Articles on TRIM54

Similar Products

Product Notes

The TRIM54 trim54 (Catalog #AAA3206833) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TRIM54 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TRIM54 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TRIM54 trim54 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IYKQESSRPL HSKAEQHLMC EEHEEEKINI YCLSCEVPTC SLCKVFGAHK. It is sometimes possible for the material contained within the vial of "TRIM54, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.