Tumor necrosis factor receptor superfamily member 1A (Tnfrsf1a) Recombinant Protein | Tnfrsf1a recombinant protein
Recombinant Rat Tumor necrosis factor receptor superfamily member 1A (Tnfrsf1a), partial
Gene Names
Tnfrsf1a; Tnfr1; TNFR-1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Tumor necrosis factor receptor superfamily member 1A (Tnfrsf1a); Recombinant Rat Tumor necrosis factor receptor superfamily member 1A (Tnfrsf1a); partial; Tnfrsf1a recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
22-211aa, Extracellular domain
Sequence
IHPSGVTGLVPSLGDREKRDNLCPQGKYAHPKNNSICCTKCHKGTYLVSDCPSPGQETVCEVCDKGTFTASQNHVRQCLSCKTCRKEMFQVEISPCKADMDTVCGCKKNQFQRYLSETHFQCVDCSPCFNGTVTIPCKEKQNTVCNCHAGFFLSGNECTPCSHCKKNQECMKLCLPPVANVTNPQDSGTA
Sequence Length
461
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Tnfrsf1a recombinant protein
This protein is a member of the TNF-receptor superfamily. This protein is one of the major receptors for the tumor necrosis factor-alpha. This receptor can activate NF-kappaB, mediate apoptosis, and function as a regulator of inflammation. Antiapoptotic protein BCL2-associated athanogene 4 (BAG4
SODD) and adaptor proteins TRADD and TRAF2 have been shown to interact with this receptor, and thus play regulatory roles in the signal transduction mediated by the receptor. Germline mutations of the extracellular domains of this receptor were found to be associated with the autosomal dominant periodic fever syndrome. The impaired receptor clearance is thought to be a mechanism of the disease.
SODD) and adaptor proteins TRADD and TRAF2 have been shown to interact with this receptor, and thus play regulatory roles in the signal transduction mediated by the receptor. Germline mutations of the extracellular domains of this receptor were found to be associated with the autosomal dominant periodic fever syndrome. The impaired receptor clearance is thought to be a mechanism of the disease.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
50,969 Da
NCBI Official Full Name
tumor necrosis factor receptor superfamily member 1A
NCBI Official Synonym Full Names
TNF receptor superfamily member 1A
NCBI Official Symbol
Tnfrsf1a
NCBI Official Synonym Symbols
Tnfr1; TNFR-1
NCBI Protein Information
tumor necrosis factor receptor superfamily member 1A
UniProt Protein Name
Tumor necrosis factor receptor superfamily member 1A
Protein Family
UniProt Gene Name
Tnfrsf1a
UniProt Synonym Gene Names
Tnfr-1; Tnfr1; TNF-R1; TNF-RI; TNFR-I
NCBI Description
may play a role in TNFalpha mediated inflammatory response to spinal cord injury [RGD, Feb 2006]
Uniprot Description
Receptor for TNFSF2/TNF-alpha and homotrimeric TNFSF1/lymphotoxin-alpha. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis ().
Research Articles on Tnfrsf1a
Similar Products
Product Notes
The Tnfrsf1a tnfrsf1a (Catalog #AAA951687) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-211aa, Extracellular domain. The amino acid sequence is listed below: IHPSGVTGLV PSLGDREKRD NLCPQGKYAH PKNNSICCTK CHKGTYLVSD CPSPGQETVC EVCDKGTFTA SQNHVRQCLS CKTCRKEMFQ VEISPCKADM DTVCGCKKNQ FQRYLSETHF QCVDCSPCFN GTVTIPCKEK QNTVCNCHAG FFLSGNECTP CSHCKKNQEC MKLCLPPVAN VTNPQDSGTA. It is sometimes possible for the material contained within the vial of "Tumor necrosis factor receptor superfamily member 1A (Tnfrsf1a), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
