Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged TNFRSF1A is 0.03 ng/ml as a capture antibody.)

Mouse TNFRSF1A Monoclonal Antibody | anti-TNFRSF1A antibody

TNFRSF1A (Tumor Necrosis Factor Receptor Superfamily, Member 1A, CD120a, FPF, MGC19588, TBP1, TNF-R, TNF-R-I, TNF-R55, TNFAR, TNFR1, TNFR55, TNFR60, p55, p55-R, p60) (APC)

Gene Names
TNFRSF1A; FPF; MS5; p55; p60; TBP1; TNF-R; TNFAR; TNFR1; p55-R; CD120a; TNFR55; TNFR60; TNF-R-I; TNF-R55; TNFR1-d2
Applications
Western Blot
Purity
Purified
Synonyms
TNFRSF1A; Monoclonal Antibody; TNFRSF1A (Tumor Necrosis Factor Receptor Superfamily; Member 1A; CD120a; FPF; MGC19588; TBP1; TNF-R; TNF-R-I; TNF-R55; TNFAR; TNFR1; TNFR55; TNFR60; p55; p55-R; p60) (APC); Tumor Necrosis Factor Receptor Superfamily; p60; anti-TNFRSF1A antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
7F12
Specificity
Recognizes TNFRSF1A.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-TNFRSF1A antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
TNFRSF1A (NP_001056.1, 40aa-149aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLC
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged TNFRSF1A is 0.03 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged TNFRSF1A is 0.03 ng/ml as a capture antibody.)
Related Product Information for anti-TNFRSF1A antibody
The protein encoded by this gene is a member of the TNF-receptor superfamily. This protein is one of the major receptors for the tumor necrosis factor-alpha. This receptor can activate NF-kappaB, mediate apoptosis, and function as a regulator of inflammation. Antiapoptotic protein BCL2-associated athanogene 4 (BAG4/SODD) and adaptor proteins TRADD and TRAF2 have been shown to interact with this receptor, and thus play regulatory roles in the signal transduction mediated by the receptor. Germline mutations of the extracellular domains of this receptor were found to be associated with the autosomal dominant periodic fever syndrome. The impaired receptor clearance is thought to be a mechanism of the disease. [provided by RefSeq]
Product Categories/Family for anti-TNFRSF1A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50,495 Da
NCBI Official Full Name
tumor necrosis factor receptor superfamily member 1A
NCBI Official Synonym Full Names
tumor necrosis factor receptor superfamily, member 1A
NCBI Official Symbol
TNFRSF1A
NCBI Official Synonym Symbols
FPF; MS5; p55; p60; TBP1; TNF-R; TNFAR; TNFR1; p55-R; CD120a; TNFR55; TNFR60; TNF-R-I; TNF-R55; TNFR1-d2
NCBI Protein Information
tumor necrosis factor receptor superfamily member 1A; TNF-R1; TNF-RI; TNFR-I; tumor necrosis factor-alpha receptor; tumor necrosis factor receptor type 1; tumor necrosis factor binding protein 1; tumor necrosis factor receptor 1A isoform beta
UniProt Protein Name
Tumor necrosis factor receptor superfamily member 1A
UniProt Gene Name
TNFRSF1A
UniProt Synonym Gene Names
TNFAR; TNFR1; TNF-R1; TNF-RI; TNFR-I; TBPI
UniProt Entry Name
TNR1A_HUMAN

NCBI Description

The protein encoded by this gene is a member of the TNF-receptor superfamily. This protein is one of the major receptors for the tumor necrosis factor-alpha. This receptor can activate NF-kappaB, mediate apoptosis, and function as a regulator of inflammation. Antiapoptotic protein BCL2-associated athanogene 4 (BAG4/SODD) and adaptor proteins TRADD and TRAF2 have been shown to interact with this receptor, and thus play regulatory roles in the signal transduction mediated by the receptor. Germline mutations of the extracellular domains of this receptor were found to be associated with the autosomal dominant periodic fever syndrome. The impaired receptor clearance is thought to be a mechanism of the disease. [provided by RefSeq, Jul 2008]

Uniprot Description

TNF-R1: Receptor for TNFSF2/TNF-alpha and homotrimeric TNFSF1/lymphotoxin-alpha. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate- specific cysteine proteases) mediating apoptosis. Contributes to the induction of non-cytocidal TNF effects including anti-viral state and activation of the acid sphingomyelinase. Binding of TNF to the extracellular domain leads to homotrimerization. The aggregated death domains provide a novel molecular interface that interacts specifically with the death domain of TRADD. Various TRADD-interacting proteins such as TRAFS, RIPK1 and possibly FADD, are recruited to the complex by their association with TRADD. This complex activates at least two distinct signaling cascades, apoptosis and NF-kappa-B signaling. Interacts with BAG4, BRE, FEM1B, GRB2, SQSTM1 and TRPC4AP. Interacts with HCV core protein. Interacts with human cytomegalovirus/HHV-5 protein UL138. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Receptor, cytokine

Chromosomal Location of Human Ortholog: 12p13.2

Cellular Component: extracellular space; cell surface; mitochondrion; integral to plasma membrane; extracellular region; cytosol; lipid raft; Golgi membrane; axon; plasma membrane; synapse; nucleus; receptor complex

Molecular Function: protein binding; tumor necrosis factor receptor activity; protease binding; protein complex binding; tumor necrosis factor binding

Biological Process: response to alkaloid; viral reproduction; protein heterooligomerization; response to lipopolysaccharide; tumor necrosis factor-mediated signaling pathway; positive regulation of neuron apoptosis; negative regulation of interleukin-6 production; response to wounding; tetrapyrrole metabolic process; inflammatory response; positive regulation of I-kappaB kinase/NF-kappaB cascade; positive regulation of protein import into nucleus, translocation; cytokine and chemokine mediated signaling pathway; response to amino acid stimulus; positive regulation of tumor necrosis factor production; prostaglandin metabolic process; positive regulation of angiogenesis; positive regulation of tyrosine phosphorylation of Stat1 protein; response to ethanol; DNA damage response, signal transduction resulting in induction of apoptosis; induction of apoptosis via death domain receptors; negative regulation of inflammatory response; defense response to bacterium; response to hypoxia; positive regulation of transcription from RNA polymerase II promoter; negative regulation of apoptosis; positive regulation of inflammatory response

Disease: Multiple Sclerosis, Susceptibility To, 5; Periodic Fever, Familial, Autosomal Dominant

Research Articles on TNFRSF1A

Similar Products

Product Notes

The TNFRSF1A tnfrsf1a (Catalog #AAA6170249) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's TNFRSF1A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TNFRSF1A tnfrsf1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TNFRSF1A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.