Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant protein Human RANK/TNFRSF11A/CD265 was determined by SDS-PAGE under reducing conditions with Coomassie Blue, showing a band at 30 kDa.)

RANK/TNFRSF11A/CD265 Recombinant Protein | RANK recombinant protein

Recombinant Human RANK/TNFRSF11A/CD265 Protein

Gene Names
TNFRSF11A; FEO; OFE; ODFR; OSTS; PDB2; RANK; CD265; OPTB7; TRANCER; LOH18CR1
Purity
>95% by SDS-PAGE.
Synonyms
RANK/TNFRSF11A/CD265; Recombinant Human RANK/TNFRSF11A/CD265 Protein; CD265; FEO; LOH18CR1; ODFR; OFE; OPTB7; OSTS; PDB2; RANK; TRANCER; RANK recombinant protein
Ordering
For Research Use Only!
Host
Human Cells
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 um filtered solution of PBS, pH 7.4.
Sequence
IAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARKPPNEPHVYLP
Sequence Length
263
Species
Human
Endotoxin
< 1 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant protein Human RANK/TNFRSF11A/CD265 was determined by SDS-PAGE under reducing conditions with Coomassie Blue, showing a band at 30 kDa.)

SDS-Page (Recombinant protein Human RANK/TNFRSF11A/CD265 was determined by SDS-PAGE under reducing conditions with Coomassie Blue, showing a band at 30 kDa.)
Related Product Information for RANK recombinant protein
Description: Recombinant Human RANK/TNFRSF11A/CD265 Protein is produced by Human Cell expression system. The target protein is expressed with sequence (Ile30-Pro212) of human RANK/TNFRSF11A/CD265 (Accession #Q9Y6Q6) fused with a 6xHis tag at the C-terminus.

Background: This protein is a member of the TNF-receptor superfamily. This receptors can interact with various TRAF family proteins, through which this receptor induces the activation of NF-kappa B and MAPK8/JNK. This receptor and its ligand are important regulators of the interaction between T cells and dendritic cells. This receptor is also an essential mediator for osteoclast and lymph node development. Mutations at this locus have been associated with familial expansile osteolysis, autosomal recessive osteopetrosis, and Paget disease of bone. Alternatively spliced transcript variants have been described for this locus.
Product Categories/Family for RANK recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
tumor necrosis factor receptor superfamily member 11A isoform 2
NCBI Official Synonym Full Names
TNF receptor superfamily member 11a
NCBI Official Symbol
TNFRSF11A
NCBI Official Synonym Symbols
FEO; OFE; ODFR; OSTS; PDB2; RANK; CD265; OPTB7; TRANCER; LOH18CR1
NCBI Protein Information
tumor necrosis factor receptor superfamily member 11A
UniProt Protein Name
Tumor necrosis factor receptor superfamily member 11A
UniProt Gene Name
TNFRSF11A
UniProt Synonym Gene Names
RANK; ODFR
UniProt Entry Name
TNR11_HUMAN

NCBI Description

The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptors can interact with various TRAF family proteins, through which this receptor induces the activation of NF-kappa B and MAPK8/JNK. This receptor and its ligand are important regulators of the interaction between T cells and dendritic cells. This receptor is also an essential mediator for osteoclast and lymph node development. Mutations at this locus have been associated with familial expansile osteolysis, autosomal recessive osteopetrosis, and Paget disease of bone. Alternatively spliced transcript variants have been described for this locus. [provided by RefSeq, Aug 2012]

Uniprot Description

TNFRSF11A: Receptor for TNFSF11/RANKL/TRANCE/OPGL; essential for RANKL-mediated osteoclastogenesis. Involved in the regulation of interactions between T-cells and dendritic cells. Binds to the clefts between the subunits of the TNFSF11 ligand trimer to form a heterohexamer. Interacts with TRAF1, TRAF2, TRAF3, TRAF5 and TRAF6. Interacts (via cytoplasmic domain) with GAB2. Ubiquitous expression with high levels in skeletal muscle, thymus, liver, colon, small intestine and adrenal gland.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 18q22.1

Cellular Component: external side of plasma membrane; integral to plasma membrane; plasma membrane

Molecular Function: cytokine binding; protein binding; receptor activity; transmembrane receptor activity; tumor necrosis factor receptor activity

Biological Process: activation of NF-kappaB transcription factor; adaptive immune response; cell-cell signaling; circadian thermoregulation; inflammatory response; osteoclast differentiation; positive regulation of cell proliferation; positive regulation of JNK activity; positive regulation of transcription factor activity; regulation of apoptosis; response to cytokine stimulus; response to lipopolysaccharide; signal transduction; tumor necrosis factor-mediated signaling pathway

Disease: Familial Expansile Osteolysis; Osteopetrosis, Autosomal Recessive 7; Paget Disease Of Bone

Research Articles on RANK

Similar Products

Product Notes

The RANK tnfrsf11a (Catalog #AAA9139891) is a Recombinant Protein produced from Human Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: IAPPCTSEKH YEHLGRCCNK CEPGKYMSSK CTTTSDSVCL PCGPDEYLDS WNEEDKCLLH KVCDTGKALV AVVAGNSTTP RRCACTAGYH WSQDCECCRR NTECAPGLGA QHPLQLNKDT VCKPCLAGYF SDAFSSTDKC RPWTNCTFLG KRVEHHGTEK SDAVCSSSLP ARKPPNEPHV YLP. It is sometimes possible for the material contained within the vial of "RANK/TNFRSF11A/CD265, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.