Transmembrane protease serine 6 (Tmprss6) Recombinant Protein | Tmprss6 recombinant protein
Recombinant Mouse Transmembrane protease serine 6 (Tmprss6), partial
Gene Names
Tmprss6; 1300008A22Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Transmembrane protease serine 6 (Tmprss6); Recombinant Mouse Transmembrane protease serine 6 (Tmprss6); partial; Tmprss6 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
81-581. Partial, provide the complete extracellular domain of the Isoform 3.
Sequence
KAEVTVSQVYSGSLRVLNRHFSQDLGRRESIAFRSESAKAQKMLQELVASTRLGTYYNSSSVYSFGEGPLTCFFWFILDIPEYQRLTLSPEVVRELLVDELLSNSSTLASYKTEYEVDPEGLVILEASVNDIVVLNSTLGCYRYSYVNPGQVLPLKGPDQQTTSCLWHLQGPEDLMIKVRLEWTRVDCRDRVAMYDAAGPLEKRLITSVYGCSRQEPVMEVLASGSVMAVVWKKGMHSYYDPFLLSVKSVAFQDCQVNLTLEGRLDTQGFLRTPYYPSYYSPSTHCSWHLTVPSLDYGLALWFDAYALRRQKYNRLCTQGQWMIQNRRLCGFRTLQPYAERIPMVASDGVTINFTSQISLTGPGVQVYYSLYNQSDPCPGEFLCSVNGLCVPACDGIKDCPNGLDERNCVCRAMFQCQEDSTCISLPRVCDRQPDCLNGSDEEQCQEGVPCGTFTFQCEDRSCVKKPNPECDGQSDCRDGSDEQHCGPLQPYCGRDRVLRG
Sequence Length
581
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Tmprss6 recombinant protein
This protein is a type II transmembrane serine proteinase that is found attached to the cell surface. The encoded protein may be involved in matrix remodeling processes in the liver.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
86.1 kDa
NCBI Official Full Name
transmembrane protease serine 6 isoform 1
NCBI Official Synonym Full Names
transmembrane serine protease 6
NCBI Official Symbol
Tmprss6
NCBI Official Synonym Symbols
1300008A22Rik
NCBI Protein Information
transmembrane protease serine 6
UniProt Protein Name
Transmembrane protease serine 6
Protein Family
UniProt Gene Name
Tmprss6
Uniprot Description
Serine protease which hydrolyzes a range of proteins including type I collagen, fibronectin and fibrinogen. Can also activate urokinase-type plasminogen activator with low efficiency. May play a specialized role in matrix remodeling processes in liver. Through the cleavage of HFE2, a regulator of the expression of the iron absorption-regulating hormone hepicidin/HAMP, plays a role in iron homeostasis.
Research Articles on Tmprss6
Similar Products
Product Notes
The Tmprss6 tmprss6 (Catalog #AAA1386401) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 81-581. Partial, provide the complete extracellular domain of the Isoform 3. The amino acid sequence is listed below: KAEVTVSQVY SGSLRVLNRH FSQDLGRRES IAFRSESAKA QKMLQELVAS TRLGTYYNSS SVYSFGEGPL TCFFWFILDI PEYQRLTLSP EVVRELLVDE LLSNSSTLAS YKTEYEVDPE GLVILEASVN DIVVLNSTLG CYRYSYVNPG QVLPLKGPDQ QTTSCLWHLQ GPEDLMIKVR LEWTRVDCRD RVAMYDAAGP LEKRLITSVY GCSRQEPVME VLASGSVMAV VWKKGMHSYY DPFLLSVKSV AFQDCQVNLT LEGRLDTQGF LRTPYYPSYY SPSTHCSWHL TVPSLDYGLA LWFDAYALRR QKYNRLCTQG QWMIQNRRLC GFRTLQPYAE RIPMVASDGV TINFTSQISL TGPGVQVYYS LYNQSDPCPG EFLCSVNGLC VPACDGIKDC PNGLDERNCV CRAMFQCQED STCISLPRVC DRQPDCLNGS DEEQCQEGVP CGTFTFQCED RSCVKKPNPE CDGQSDCRDG SDEQHCGPLQ PYCGRDRVLR G . It is sometimes possible for the material contained within the vial of "Transmembrane protease serine 6 (Tmprss6), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
