Transmembrane protease serine 4 (TMPRSS4) Recombinant Protein | TMPRSS4 recombinant protein
Recombinant Human Transmembrane protease serine 4 (TMPRSS4), partial
Gene Names
TMPRSS4; CAPH2; MT-SP2; TMPRSS3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Transmembrane protease serine 4 (TMPRSS4); Recombinant Human Transmembrane protease serine 4 (TMPRSS4); partial; TMPRSS4 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
54-437aa; Extracellular Domain
Sequence
KVILDKYYFLCGQPLHFIPRKQLCDGELDCPLGEDEEHCVKSFPEGPAVAVRLSKDRSTLQVLDSATGNWFSACFDNFTEALAETACRQMGYSSKPTFRAVEIGPDQDLDVVEITENSQELRMRNSSGPCLSGSLVSLHCLACGKSLKTPRVVGVEEASVDSWPWQVSIQYDKQHVCGGSILDPHWVLTAAHCFRKHTDVFNWKVRAGSDKLGSFPSLAVAKIIIIEFNPMYPKDNDIALMKLQFPLTFSGTVRPICLPFFDEELTPATPLWIIGWGFTKQNGGKMSDILLQASVQVIDSTRCNADDAYQGEVTEKMMCAGIPEGGVDTCQGDSGGPLMYQSDQWHVVGIVSWGYGCGGPSTPGVYTKVSAYLNWIYNVWKAEL
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for TMPRSS4 recombinant protein
This gene encodes a member of the serine protease family. Serine proteases are known to be involved in a variety of biological processes, whose malfunction often leads to human diseases and disorders. This gene was identified as a gene overexpressed in pancreatic carcinoma. The encoded protein is membrane bound with a N-terminal anchor sequence and a glycosylated extracellular region containing the serine protease domain. Multiple transcript variants encoding different isoforms have been found for this gene.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
43,786 Da
NCBI Official Full Name
transmembrane protease serine 4 isoform 3
NCBI Official Synonym Full Names
transmembrane serine protease 4
NCBI Official Symbol
TMPRSS4
NCBI Official Synonym Symbols
CAPH2; MT-SP2; TMPRSS3
NCBI Protein Information
transmembrane protease serine 4
UniProt Protein Name
Transmembrane protease serine 4
Protein Family
UniProt Gene Name
TMPRSS4
UniProt Synonym Gene Names
TMPRSS3; CAPH2; MT-SP2
NCBI Description
This gene encodes a member of the serine protease family. Serine proteases are known to be involved in a variety of biological processes, whose malfunction often leads to human diseases and disorders. This gene was identified as a gene overexpressed in pancreatic carcinoma. The encoded protein is membrane bound with a N-terminal anchor sequence and a glycosylated extracellular region containing the serine protease domain. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Uniprot Description
Probable protease. Seems to be capable of activating ENaC ().
Research Articles on TMPRSS4
Similar Products
Product Notes
The TMPRSS4 tmprss4 (Catalog #AAA1430321) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 54-437aa; Extracellular Domain. The amino acid sequence is listed below: KVILDKYYFL CGQPLHFIPR KQLCDGELDC PLGEDEEHCV KSFPEGPAVA VRLSKDRSTL QVLDSATGNW FSACFDNFTE ALAETACRQM GYSSKPTFRA VEIGPDQDLD VVEITENSQE LRMRNSSGPC LSGSLVSLHC LACGKSLKTP RVVGVEEASV DSWPWQVSIQ YDKQHVCGGS ILDPHWVLTA AHCFRKHTDV FNWKVRAGSD KLGSFPSLAV AKIIIIEFNP MYPKDNDIAL MKLQFPLTFS GTVRPICLPF FDEELTPATP LWIIGWGFTK QNGGKMSDIL LQASVQVIDS TRCNADDAYQ GEVTEKMMCA GIPEGGVDTC QGDSGGPLMY QSDQWHVVGI VSWGYGCGGP STPGVYTKVS AYLNWIYNVW KAEL. It is sometimes possible for the material contained within the vial of "Transmembrane protease serine 4 (TMPRSS4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
