Transmembrane protein 8B (Tmem8b) Recombinant Protein | Tmem8b recombinant protein
Recombinant Mouse Transmembrane protein 8B (Tmem8b)
Gene Names
Tmem8b; 4930500O05Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Transmembrane protein 8B (Tmem8b); Recombinant Mouse Transmembrane protein 8B (Tmem8b); Recombinant Transmembrane protein 8B (Tmem8b); Transmembrane protein 8B; Protein NGX6; Tmem8b recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-472
Sequence
MNMPQSLGTQPLPPEPPSLGTPIEGSGAIAPTEHCWPVRPTLRNELDTFSVHFYIFFGPSVALPPERPAVFALRLLPVLDSGGVLSLELQLNASSLRQENVTVFGCLTHEVPLSLGDAAVTCSKESLAGFLLSVSATSRVARLRIPFPQTGTWFLTLRSLCGVGPRFVRCRNATAEVRLRTFLSPCVDDCGPYGQCKLLRTHNYLYAACECKAGWRGWGCTDSADALTYGFQLLSTLLLCLSNLMFLPPVVLAIRSRYVLEAAVYTFTMFFSTFYHACDQPGIVVFCIMDYDVLQFCDFLGSLMSVWVTVIAMARLQPVIKQVLYLLGAMLLSMALQLDRHGLWNLLGPSLFALGILATAWTVRSVRRRHCYPPTWRRWLFYLCPGSLIAGSAVLLYAFVETRDNYFYIHSIWHMLIAGSVGFLLPPRAKTDRRVPSGARARGCGYQLCINEQEELGLVGPGGTTVSSICVS
Sequence Length
472
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
52,114 Da
NCBI Official Full Name
transmembrane protein 8B
NCBI Official Synonym Full Names
transmembrane protein 8B
NCBI Official Symbol
Tmem8b
NCBI Official Synonym Symbols
4930500O05Rik
NCBI Protein Information
transmembrane protein 8B
UniProt Protein Name
Transmembrane protein 8B
Protein Family
UniProt Gene Name
Tmem8b
UniProt Entry Name
TMM8B_MOUSE
Uniprot Description
TMEM8B: May function as a regulator of the EGFR pathway. Probable tumor suppressor which may function in cell growth, proliferation and adhesion. Belongs to the TMEM8 family. 3 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, multi-pass; Membrane protein, integral
Cellular Component: cell surface; membrane; mitochondrion; endoplasmic reticulum; cytoplasm; integral to membrane; plasma membrane; nucleus
Biological Process: cell-matrix adhesion; regulation of growth; cell adhesion
Similar Products
Product Notes
The Tmem8b tmem8b (Catalog #AAA1245301) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-472. The amino acid sequence is listed below: MNMPQSLGTQ PLPPEPPSLG TPIEGSGAIA PTEHCWPVRP TLRNELDTFS VHFYIFFGPS VALPPERPAV FALRLLPVLD SGGVLSLELQ LNASSLRQEN VTVFGCLTHE VPLSLGDAAV TCSKESLAGF LLSVSATSRV ARLRIPFPQT GTWFLTLRSL CGVGPRFVRC RNATAEVRLR TFLSPCVDDC GPYGQCKLLR THNYLYAACE CKAGWRGWGC TDSADALTYG FQLLSTLLLC LSNLMFLPPV VLAIRSRYVL EAAVYTFTMF FSTFYHACDQ PGIVVFCIMD YDVLQFCDFL GSLMSVWVTV IAMARLQPVI KQVLYLLGAM LLSMALQLDR HGLWNLLGPS LFALGILATA WTVRSVRRRH CYPPTWRRWL FYLCPGSLIA GSAVLLYAFV ETRDNYFYIH SIWHMLIAGS VGFLLPPRAK TDRRVPSGAR ARGCGYQLCI NEQEELGLVG PGGTTVSSIC VS. It is sometimes possible for the material contained within the vial of "Transmembrane protein 8B (Tmem8b), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
