Cell cycle control protein 50B (Tmem30b) Recombinant Protein | Tmem30b recombinant protein
Recombinant Mouse Cell cycle control protein 50B (Tmem30b)
Gene Names
Tmem30b; 9130011B11Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cell cycle control protein 50B (Tmem30b); Recombinant Mouse Cell cycle control protein 50B (Tmem30b); Tmem30b recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-353aa; full length protein
Sequence
MTWSATARGAHQPDNTAFTQQRLPAWQPLLSAGIALPLFFCAGLAFIGLGLGLFYSSNGI KELEYDYTGNPGTGDCSVCAAKGQGRAPPPGCACSWSFTLPELFPGPVYLYYELSNFYQN NRRYGVSRDDAQLSGLASALRHPANECAPYQFRSDGLPIAPCGAIANSLFNDSFSLWHQR QPSDPFVEVPLDRTAIAWWTDYHVKFRNPPLVNGSLALAFRGTAPPPNWHRPVYELSPDP NNTGFINQDFVVWMRTAALPTFRKLYARIRQGNYSAGLPRGTYRVNITYNYPVRAFGGHK LIILSNISWMGGKNPFLGIAYLVVGSLCIVMGFVMLVVYIRYQDQDDDDNDDE
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Tmem30b recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39,218 Da
NCBI Official Full Name
cell cycle control protein 50B
NCBI Official Synonym Full Names
transmembrane protein 30B
NCBI Official Symbol
Tmem30b
NCBI Official Synonym Symbols
9130011B11Rik
NCBI Protein Information
cell cycle control protein 50B
UniProt Protein Name
Cell cycle control protein 50B
Protein Family
UniProt Gene Name
Tmem30b
UniProt Synonym Gene Names
Cdc50b
UniProt Entry Name
CC50B_MOUSE
Uniprot Description
TMEM30B: Belongs to the CDC50/LEM3 family.
Protein type: Membrane protein, integral; Membrane protein, multi-pass
Cellular Component: integral to membrane; membrane; plasma membrane
Biological Process: lipid transport; transport
Similar Products
Product Notes
The Tmem30b tmem30b (Catalog #AAA7031818) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-353aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Tmem30b tmem30b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MTWSATARGA HQPDNTAFTQ QRLPAWQPLL SAGIALPLFF CAGLAFIGLG LGLFYSSNGI KELEYDYTGN PGTGDCSVCA AKGQGRAPPP GCACSWSFTL PELFPGPVYL YYELSNFYQN NRRYGVSRDD AQLSGLASAL RHPANECAPY QFRSDGLPIA PCGAIANSLF NDSFSLWHQR QPSDPFVEVP LDRTAIAWWT DYHVKFRNPP LVNGSLALAF RGTAPPPNWH RPVYELSPDP NNTGFINQDF VVWMRTAALP TFRKLYARIR QGNYSAGLPR GTYRVNITYN YPVRAFGGHK LIILSNISWM GGKNPFLGIA YLVVGSLCIV MGFVMLVVYI RYQDQDDDDN DDE. It is sometimes possible for the material contained within the vial of "Cell cycle control protein 50B (Tmem30b), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
