Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Toll-like receptor 8 Recombinant Protein | TLR8 recombinant protein

Recombinant Human Toll-like receptor 8

Gene Names
TLR8; CD288
Purity
Greater than 90% as determined by SDS-PAGE.
Synonyms
Toll-like receptor 8; Recombinant Human Toll-like receptor 8; CD288; TLR8 recombinant protein
Ordering
For Research Use Only!
Host
Yeast
Purity/Purification
Greater than 90% as determined by SDS-PAGE.
Form/Format
Tris-based buffer 50% glycerol.
Sequence Positions
Full Length, 27-827
Sequence
EENFSRSYPCDEKKQNDSVIAECSNRRLQEVPQTVGKYVTELDLSDNFITHITNESFQGLQNLTKINLNHNPNV QHQNGNPGIQSNGLNITDGAFLNLKNLRELLLEDNQLPQIPSGLPESLTELSLIQNNIYNITKEGISRLINLKNLYL AWNCYFNKVCEKTNIEDGVFETLTNLELLSLSFNSLSHVPPKLPSSLRKLFLSNTQIKYISEEDFKGLINLTLLDL SGNCPRCFNAPFPCVPCDGGASINIDRFAFQNLTQLRYLNLSSTSLRKINAAWFKNMPHLKVLDLEFNYLVGEI ASGAFLTMLPRLEILDLSFNYIKGSYPQHINISRNFSKLLSLRALHLRGYVFQELREDDFQPLMQLPNLSTINLGI NFIKQIDFKLFQNFSNLEIIYLSENRISPLVKDTRQSYANSSSFQRHIRKRRSTDFEFDPHSNFYHFTRPLIKPQC AAYGKALDLSLNSIFFIGPNQFENLPDIACLNLSANSNAQVLSGTEFSAIPHVKYLDLTNNRLDFDNASALTELS DLEVLDLSYNSHYFRIAGVTHHLEFIQNFTNLKVLNLSHNNIYTLTDKYNLESKSLVELVFSGNRLDILWNDDDN RYISIFKGLKNLTRLDLSLNRLKHIPNEAFLNLPASLTELHINDNMLKFFNWTLLQQFPRLELLDLRGNKLLFLTD SLSDFTSSLRTLLLSHNRISHLPSGFLSEVSSLKHLDLSSNLLKTINKSALETKTTTKLSMLELHGNPFECTCDIG DFRRWMDEHLNVKIPRLVDVICASPGDQRGKSIVSLELTTCVSDVT
Calculated MW
93.5 kDa
Tag info
N-terminal 6xHis-tagged
Immunogen Description
Expression Region:27-827 Sequence Info: partial
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.

Generally, the shelf life of liquid form is 6 months at -20°C to -80°C. The shelf life of lyophilized form is 12 months at -20°C to -80°C.

Notes: Repeated freezing and thawing is not recommended . Store working aliquots at 4°C for up to one week.
Related Product Information for TLR8 recombinant protein
Key component of innate and adaptive immunity. TLRs (Toll-like receptors) control host immune response against pathogens through recognition of molecular patterns specific to microorganisms. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
toll-like receptor 8 isoform 1
NCBI Official Synonym Full Names
toll like receptor 8
NCBI Official Symbol
TLR8
NCBI Official Synonym Symbols
CD288
NCBI Protein Information
toll-like receptor 8
UniProt Protein Name
Toll-like receptor 8
Protein Family
UniProt Gene Name
TLR8

NCBI Description

The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene is predominantly expressed in lung and peripheral blood leukocytes, and lies in close proximity to another family member, TLR7, on chromosome X. [provided by RefSeq, Jul 2008]

Uniprot Description

TLR8: Key component of innate and adaptive immunity. TLRs (Toll-like receptors) control host immune response against pathogens through recognition of molecular patterns specific to microorganisms. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Belongs to the Toll-like receptor family.

Protein type: Membrane protein, integral; Receptor, misc.

Chromosomal Location of Human Ortholog: Xp22.2

Cellular Component: endoplasmic reticulum membrane; endosome membrane; external side of plasma membrane; Golgi membrane; integral to membrane; integral to plasma membrane

Molecular Function: DNA binding; double-stranded RNA binding; receptor activity; RNA binding; single-stranded RNA binding

Biological Process: defense response to virus; I-kappaB kinase/NF-kappaB cascade; immunoglobulin mediated immune response; inflammatory response; positive regulation of innate immune response; positive regulation of interferon-alpha biosynthetic process; positive regulation of interferon-beta biosynthetic process; positive regulation of interferon-gamma biosynthetic process; positive regulation of interleukin-1 beta secretion; positive regulation of interleukin-8 biosynthetic process; response to virus; toll-like receptor 8 signaling pathway; toll-like receptor 9 signaling pathway; toll-like receptor signaling pathway

Research Articles on TLR8

Similar Products

Product Notes

The TLR8 tlr8 (Catalog #AAA9422527) is a Recombinant Protein produced from Yeast and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is Full Length, 27-827. The amino acid sequence is listed below: EENFSRSYPC DEKKQNDSVI AECSNRRLQE VPQTVGKYVT ELDLSDNFIT HITNESFQGL QNLTKINLNH NPNV QHQN GNPGIQSNGL NITDGAFLNL KNLRELLLED NQLPQIPSGL PESLTELSLI QNNIYNITKE GISRLINLKN LYL AWNCY FNKVCEKTNI EDGVFETLTN LELLSLSFNS LSHVPPKLPS SLRKLFLSNT QIKYISEEDF KGLINLTLLD L SGNCPRC FNAPFPCVPC DGGASINIDR FAFQNLTQLR YLNLSSTSLR KINAAWFKNM PHLKVLDLEF NYLVGEI A SGAFLTMLPR LEILDLSFNY IKGSYPQHIN ISRNFSKLLS LRALHLRGYV FQELREDDFQ PLMQLPNLST INLGI NFI KQIDFKLFQN FSNLEIIYLS ENRISPLVKD TRQSYANSSS FQRHIRKRRS TDFEFDPHSN FYHFTRPLIK PQC AAYGK ALDLSLNSIF FIGPNQFENL PDIACLNLSA NSNAQVLSGT EFSAIPHVKY LDLTNNRLDF DNASALTELS DLEVLDLS YNSHYFRIAG VTHHLEFIQN FTNLKVLNLS HNNIYTLTDK YNLESKSLVE LVFSGNRLDI LWNDDDN R YISIFKGLKN LTRLDLSLNR LKHIPNEAFL NLPASLTELH INDNMLKFFN WTLLQQFPRL ELLDLRGNKL LFLTD SLS DFTSSLRTLL LSHNRISHLP SGFLSEVSSL KHLDLSSNLL KTINKSALET KTTTKLSMLE LHGNPFECTC DIG DFRRW MDEHLNVKIP RLVDVICASP GDQRGKSIVS LELTTCVSDV T . It is sometimes possible for the material contained within the vial of "Toll-like receptor 8, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.