Mitochondrial import inner membrane translocase subunit Tim10 (TIMM10) Recombinant Protein | TIMM10 recombinant protein

Recombinant Human Mitochondrial import inner membrane translocase subunit Tim10 (TIMM10)

Cat. Num. AAA964155

• Gene Names: TIMM10; TIM10; TIM10A; TIMM10A
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Mitochondrial import inner membrane translocase subunit Tim10 (TIMM10); Recombinant Human Mitochondrial import inner membrane translocase subunit Tim10 (TIMM10); TIMM10 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-90, Full length protein
• Sequence: MDPLRAQQLAAELEVEMMADMYNRMTSACHRKCVPPHYKEAELSKGESVCLDRCVSKYLDIHERMGKKLTELSMQDEELMKRVQQSSGPA
• Sequence Length: 90

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 6912708
• NCBI GeneID: 26519
• NCBI Accession #: NP_036588.1
• NCBI GenBank Nucleotide #: NM_012456.2
• UniProt Accession #: P62072; Q9WV99; Q9WVA0; Q9Y5J8; A8K136
• Molecular Weight: 10,333 Da
• NCBI Official Full Name: mitochondrial import inner membrane translocase subunit Tim10
• NCBI Official Synonym Full Names: translocase of inner mitochondrial membrane 10
• NCBI Official Symbol: TIMM10
• NCBI Official Synonym Symbols: TIM10; TIM10A; TIMM10A
• NCBI Protein Information: mitochondrial import inner membrane translocase subunit Tim10
• UniProt Protein Name: Mitochondrial import inner membrane translocase subunit Tim10
• UniProt Gene Name: TIMM10
• UniProt Synonym Gene Names: TIM10

NCBI Description

The mitochondrial protein encoded by this gene belongs to a family of evolutionarily conserved proteins that are organized in heterooligomeric complexes in the mitochondrial intermembrane space. These proteins mediate the import and insertion of hydrophobic membrane proteins into the mitochondrial inner membrane, functioning as intermembrane space chaperones for the highly insoluble carrier proteins. [provided by RefSeq, Nov 2011]

Uniprot Description

Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. May also be required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space.