Mitochondrial import inner membrane translocase subunit TIM12 (TIM12) Recombinant Protein | TIM12 recombinant protein
Recombinant Saccharomyces cerevisiae Mitochondrial import inner membrane translocase subunit TIM12 (TIM12)
Gene Names
TIM12; MRS5
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Mitochondrial import inner membrane translocase subunit TIM12 (TIM12); Recombinant Saccharomyces cerevisiae Mitochondrial import inner membrane translocase subunit TIM12 (TIM12); TIM12 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-109, full length protein
Sequence
SFFLNSLRGNQEVSQEKLDVAGVQFDAMCSTFNNILSTCLEKCIPHEGFGEPDLTKGEQCCIDRCVAKMHYSNRLIGGFVQTRGFGPENQLRHYSRFVAKEIADDSKK
Sequence Length
108
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
12,284 Da
NCBI Official Full Name
Tim12p
NCBI Official Symbol
TIM12
NCBI Official Synonym Symbols
MRS5
NCBI Protein Information
Tim12p
UniProt Protein Name
Mitochondrial import inner membrane translocase subunit TIM12
Protein Family
UniProt Gene Name
TIM12
UniProt Synonym Gene Names
MRS5
Uniprot Description
Essential component of the TIM22 complex, a complex that mediates the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. The TIM22 complex forms a twin-pore translocase that uses the membrane potential as external driving force. In the TIM22 complex, it acts as a docking point for the soluble TIM9-TIM10 heterohexamer that guides the target proteins in transit through the aqueous mitochondrial intermembrane space.
Research Articles on TIM12
Similar Products
Product Notes
The TIM12 tim12 (Catalog #AAA1090313) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-109, full length protein. The amino acid sequence is listed below: SFFLNSLRGN QEVSQEKLDV AGVQFDAMCS TFNNILSTCL EKCIPHEGFG EPDLTKGEQC CIDRCVAKMH YSNRLIGGFV QTRGFGPENQ LRHYSRFVAK EIADDSKK. It is sometimes possible for the material contained within the vial of "Mitochondrial import inner membrane translocase subunit TIM12 (TIM12), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
