Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (35.02kD).)

Mouse anti-Human C21orf33 Monoclonal Antibody | anti-C21orf33 antibody

C21orf33 (Chromosome 21 Open Reading Frame 33, HES1, KNPI, ES1 Protein Homolog, Mitochondrial, Protein GT335, Protein KNP-I) APC

Gene Names
C21orf33; ES1; HES1; KNPH; KNPI; GT335
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
C21orf33; Monoclonal Antibody; C21orf33 (Chromosome 21 Open Reading Frame 33; HES1; KNPI; ES1 Protein Homolog; Mitochondrial; Protein GT335; Protein KNP-I) APC; anti-C21orf33 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1F5
Specificity
Recognizes human C21orf33.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-C21orf33 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa188-269 from C21orf33 (NP_004640) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RGVEVTVGHEQEEGGKWPYAGTAEAIKALGAKHCVKEVVEAHVDQKNKVVTTPAFMCETALHYIHDGIGAMVRKVLELTGK*
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.02kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.02kD).)

Western Blot (WB)

(C21orf33 monoclonal antibody, Western Blot analysis of C21orf33 expression in HeLa.)

Western Blot (WB) (C21orf33 monoclonal antibody, Western Blot analysis of C21orf33 expression in HeLa.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to C21orf33 on HeLa cell. [antibody concentration 10ug/ml).)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to C21orf33 on HeLa cell. [antibody concentration 10ug/ml).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to C21orf33 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to C21orf33 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged C21orf33 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged C21orf33 is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-C21orf33 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
24,758 Da
NCBI Official Full Name
ES1 protein homolog, mitochondrial isoform Ia
NCBI Official Synonym Full Names
chromosome 21 open reading frame 33
NCBI Official Symbol
C21orf33
NCBI Official Synonym Symbols
ES1; HES1; KNPH; KNPI; GT335
NCBI Protein Information
ES1 protein homolog, mitochondrial; Keio novel protein I; human HES1 protein, homolog to E.coli and zebrafish ES1 protein
UniProt Protein Name
ES1 protein homolog, mitochondrial
UniProt Gene Name
C21orf33
UniProt Synonym Gene Names
HES1; KNPI
UniProt Entry Name
ES1_HUMAN

Similar Products

Product Notes

The C21orf33 c21orf33 (Catalog #AAA6135586) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The C21orf33 (Chromosome 21 Open Reading Frame 33, HES1, KNPI, ES1 Protein Homolog, Mitochondrial, Protein GT335, Protein KNP-I) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's C21orf33 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the C21orf33 c21orf33 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "C21orf33, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.