SDS-PAGE
Thy-1 membrane glycoprotein (THY1) Recombinant Protein | THY1 recombinant protein
Recombinant Human Thy-1 membrane glycoprotein (THY1)
Gene Names
THY1; CD90; CDw90
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Thy-1 membrane glycoprotein (THY1); Recombinant Human Thy-1 membrane glycoprotein (THY1); THY1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
20-130, Full length protein
Sequence
QKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKC
Sequence Length
111
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-PAGE
SDS-PAGE
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
17,935 Da
NCBI Official Full Name
thy-1 membrane glycoprotein preproprotein
NCBI Official Synonym Full Names
Thy-1 cell surface antigen
NCBI Official Symbol
THY1
NCBI Official Synonym Symbols
CD90; CDw90
NCBI Protein Information
thy-1 membrane glycoprotein
UniProt Protein Name
Thy-1 membrane glycoprotein
Protein Family
UniProt Gene Name
THY1
NCBI Description
This gene encodes a cell surface glycoprotein and member of the immunoglobulin superfamily of proteins. The encoded protein is involved in cell adhesion and cell communication in numerous cell types, but particularly in cells of the immune and nervous systems. The encoded protein is widely used as a marker for hematopoietic stem cells. This gene may function as a tumor suppressor in nasopharyngeal carcinoma. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2015]
Uniprot Description
May play a role in cell-cell or cell-ligand interactions during synaptogenesis and other events in the brain.
Research Articles on THY1
Similar Products
Product Notes
The THY1 thy1 (Catalog #AAA968561) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 20-130, Full length protein. The amino acid sequence is listed below: QKVTSLTACL VDQSLRLDCR HENTSSSPIQ YEFSLTRETK KHVLFGTVGV PEHTYRSRTN FTSKYNMKVL YLSAFTSKDE GTYTCALHHS GHSPPISSQN VTVLRDKLVK C. It is sometimes possible for the material contained within the vial of "Thy-1 membrane glycoprotein (THY1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
