Thiamine thiazole synthase, chloroplastic (THI1) Recombinant Protein | THI1 recombinant protein
Recombinant Citrus sinensis Thiamine thiazole synthase, chloroplastic (THI1)
Gene Names
LOC102626594; thi; THI1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Thiamine thiazole synthase; chloroplastic (THI1); Recombinant Citrus sinensis Thiamine thiazole synthase; THI1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
52-356, Full length protein
Sequence
ASASPPYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKNPNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNAVAAEDLIVKGGRVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGQPNALDGTYVGGVHPELILAAADSAETADA
Sequence Length
305
Species
Citrus sinensis (Sweet orange) (Citrus aurantium var. sinensis)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37,595 Da
NCBI Official Full Name
thiamine thiazole synthase, chloroplastic
NCBI Official Symbol
LOC102626594
NCBI Official Synonym Symbols
thi; THI1
NCBI Protein Information
thiamine thiazole synthase, chloroplastic
UniProt Protein Name
Thiamine thiazole synthase, chloroplastic
Protein Family
UniProt Gene Name
THI1
Uniprot Description
Involved in biosynthesis of the thiamine precursor thiazole. Catalyzes the conversion of NAD and glycine to adenosine diphosphate 5-(2-hydroxyethyl)-4-methylthiazole-2-carboxylic acid (ADT), an adenylated thiazole intermediate. The reaction includes an iron-dependent sulfide transfer from a conserved cysteine residue of the protein to a thiazole intermediate. The enzyme can only undergo a single turnover, which suggests it is a suicide enzyme. May have additional roles in adaptation to various stress conditions and in DNA damage tolerance.
Similar Products
Product Notes
The THI1 thi1 (Catalog #AAA1218601) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 52-356, Full length protein. The amino acid sequence is listed below: ASASPPYDLN TFKFDPIKES IVSREMTRRY MTDMITYADT DVVVVGAGSA GLSCAYELSK NPNIQIAIIE QSVSPGGGAW LGGQLFSAMV VRKPAHIFLD ELGIDYDEQD NYVVIKHAAL FTSTIMSKLL ARPNVKLFNA VAAEDLIVKG GRVGGVVTNW ALVSMNHDTQ SCMDPNVMEA KVVVSSCGHD GPFGATGVKR LKSIGMIEEV PGMKALDMNS AEDAIVRLTR EVVPGMIVTG MEVAEIDGAP RMGPTFGAMM ISGQKAAHLA LKSLGQPNAL DGTYVGGVHP ELILAAADSA ETADA. It is sometimes possible for the material contained within the vial of "Thiamine thiazole synthase, chloroplastic (THI1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
