Thioesterase superfamily member 4 (Them4) Recombinant Protein | Them4 recombinant protein
Recombinant Rat Thioesterase superfamily member 4 (Them4)
Gene Names
Them4; RGD1304723
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Thioesterase superfamily member 4 (Them4); Recombinant Rat Thioesterase superfamily member 4 (Them4); Them4 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-230, full length protein
Sequence
MLRSCAMRLRTLGATPARRPEATRRLFSSEEVVCKDYALPNPSWTKDLRLLFDQFMKKCEDGSWKRLPSYRQNPPQALQEFQTHFVDSKFKKEEQMSKAQQFTRSLEEGLGFEYAMFYNKAEKRIVCLFQGGLHLQGMPGFVHGGAIATIIDITAGMCAFSEGIVMTANLNIDYKKPIPLLSVVVVNSQLQKIEGRKLFVSCTIQSTDEKTLHTQATALFIKLDPDKPLT
Sequence Length
230
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Them4 recombinant protein
Protein kinase B (PKB) is a major downstream target of receptor tyrosine kinases that signal via phosphatidylinositol 3-kinase. Upon cell stimulation, PKB is translocated to the plasma membrane, where it is phosphorylated in the C-terminal regulatory domain. This protein negatively regulates PKB activity by inhibiting phosphorylation. Transcription of this gene is commonly downregulated in glioblastomas.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26,089 Da
NCBI Official Full Name
acyl-coenzyme A thioesterase THEM4
NCBI Official Synonym Full Names
thioesterase superfamily member 4
NCBI Official Symbol
Them4
NCBI Official Synonym Symbols
RGD1304723
NCBI Protein Information
acyl-coenzyme A thioesterase THEM4
UniProt Protein Name
Acyl-coenzyme A thioesterase THEM4
Protein Family
UniProt Gene Name
Them4
UniProt Synonym Gene Names
Acyl-CoA thioesterase THEM4
Uniprot Description
Has acyl-CoA thioesterase activity towards medium and long-chain (C14 to C18) fatty acyl-CoA substrates, and probably plays an role in mitochondrial fatty acid metabolism. Plays a role in the apoptotic process, possibly via its regulation of AKT1 activity.
Research Articles on Them4
Similar Products
Product Notes
The Them4 them4 (Catalog #AAA7057274) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-230, full length protein. The amino acid sequence is listed below: MLRSCAMRLR TLGATPARRP EATRRLFSSE EVVCKDYALP NPSWTKDLRL LFDQFMKKCE DGSWKRLPSY RQNPPQALQE FQTHFVDSKF KKEEQMSKAQ QFTRSLEEGL GFEYAMFYNK AEKRIVCLFQ GGLHLQGMPG FVHGGAIATI IDITAGMCAF SEGIVMTANL NIDYKKPIPL LSVVVVNSQL QKIEGRKLFV SCTIQSTDEK TLHTQATALF IKLDPDKPLT. It is sometimes possible for the material contained within the vial of "Thioesterase superfamily member 4 (Them4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
