Movement protein TGB2 (ORF3) Recombinant Protein | ORF3 recombinant protein

Recombinant Movement protein TGB2 (ORF3)

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Movement protein TGB2 (ORF3); Recombinant Movement protein TGB2 (ORF3); Movement protein TGB2; 12 kDa protein Triple gene block 2 protein; TGBp2; ORF3 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-127
• Sequence: MSLSHGTGAPAISTPLTLRPPPDNTKAILTIAIGIAASLVFFMLTRNNLPHVGDNIHSLPHGGSYIDGTKSINYRPPASRYPSSNLLAFAPPILAAVLFFLTQPYLATRRSRCVRCFVVHGACTNHT
• Sequence Length: 105

• Species: Foxtail mosaic virus
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

• NCBI GI #: 9626711
• NCBI GeneID: 1494011
• NCBI Accession #: NP_040990.1
• NCBI GenBank Nucleotide #: NC_001483.1
• UniProt Accession #: P22170; B1NLP6; JQ1260
• Molecular Weight: 13,637 Da
• NCBI Official Full Name: 11K triple gene block protein
• NCBI Official Symbol: ORF3
• NCBI Protein Information: 11K triple gene block protein
• UniProt Protein Name: Movement protein TGB2
• Protein Family: Movement protein
• UniProt Gene Name: TGBp2
• UniProt Synonym Gene Names: TGBp2
• UniProt Entry Name: TGB2_FXMV

Uniprot Description

Function: Plays a role in viral cell-to-cell propagation, by facilitating genome transport to neighboring plant cells through plasmosdesmata,

By similarity.

Subcellular location: Host endoplasmic reticulum membrane

By similarity.

Miscellaneous: TGBp1, TGBp2 and TGBp3 seem to act together for cell-to-cell propagation. TGBp1 is the main movement protein that physically cross the plasmodesma with the viral genome. TGBp2 and TGBp3 would facilitate TGBp1 function.

Sequence similarities: Belongs to the Tymovirales TGBp2 protein family.