Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Movement protein TGB2 Recombinant Protein | BSMVs2gp3 recombinant protein

Recombinant Barley stripe mosaic virus Movement protein TGB2

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Movement protein TGB2; Recombinant Barley stripe mosaic virus Movement protein TGB2; Recombinant Movement protein TGB2; 14 kDa protein Beta-D protein Triple gene block 2 protein; TGBp2 Cleaved into the following chain: 1. TGB2' protein; BSMVs2gp3 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-131
Sequence
MKTTVGSRPNKYWPIVAGIGVVGLFAYLIFSNQKHSTESGDNIHKFANGGSYRDGSKSISYNRNHPFAYGNASSPGMLLPAMLTIIGIISYLWRTRDSVLGDSGGNNSCGEDCQGECLNGHSRRSLLCDIG
Sequence Length
204
Species
Barley stripe mosaic virus (BSMV)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22,670 Da
NCBI Official Full Name
beta C protein
NCBI Official Symbol
BSMVs2gp3
NCBI Protein Information
putative transport protein; beta C protein
UniProt Protein Name
Movement protein TGB2
Protein Family
UniProt Gene Name
TGBp2
UniProt Synonym Gene Names
TGBp2
UniProt Entry Name
TGB2_BSMV

Uniprot Description

Function: Participates in the transport of viral RNA to the plasmodesmata. Is probably targeted to plasmodesmata by TGBp3, along with viral RNAs-TGBp1 (RNP complex). Can gate plasmodesmata and increase their size exclusion limit

By similarity.

Subunit structure: Interacts with movement protein TGB3. Ref.2

Subcellular location: Host cell junction › host plasmodesma

Potential. Host endoplasmic reticulum membrane; Multi-pass membrane protein

Potential. Note: localizes to plasmodesmata or plasmodesmata-associated membrane compartments called peripheral membrane bodies (PMBs)

Potential.

Miscellaneous: This protein is translated as a fusion protein by episodic readthrough of a termination codon. Readthrough of the terminator codon TGA occurs between the codons for Gly-131 and Ser-133, thereby producing TGB2' minor translational readthrough protein.The genome of this virus consists of three linear, positive, single-stranded RNAs encapsidated in separate virions designated RNA-alpha, RNA-beta and RNA-gamma. Three proteins (alpha-A, beta-A and gamma-A) are translated directly from these genomic RNAs and the remaining proteins encoded on RNA-beta (beta-B, beta-C and beta-D) and RNA-gamma (gamma-B) are expressed via three subgenomic messenger RNAs.

Sequence similarities: Belongs to the virgaviridae/benyvirus TGB2 movement protein family.

Similar Products

Product Notes

The BSMVs2gp3 tgbp2 (Catalog #AAA1140809) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-131. The amino acid sequence is listed below: MKTTVGSRPN KYWPIVAGIG VVGLFAYLIF SNQKHSTESG DNIHKFANGG SYRDGSKSIS YNRNHPFAYG NASSPGMLLP AMLTIIGIIS YLWRTRDSVL GDSGGNNSCG EDCQGECLNG HSRRSLLCDI G. It is sometimes possible for the material contained within the vial of "Movement protein TGB2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.