Testis-expressed sequence 19 protein (TEX19) Recombinant Protein | TEX19 recombinant protein

Recombinant Human Testis-expressed sequence 19 protein (TEX19)

Cat. Num. AAA1480955

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Testis-expressed sequence 19 protein (TEX19); Recombinant Human Testis-expressed sequence 19 protein (TEX19); TEX19 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-164, Full length protein
• Sequence: MCPPVSMRYEEEGMSYLYASWMYQLQHGDQLSICFTCFKAAFLDFKDLLESEDWEEDNWDPELMEHTEAESEQEGSSGMELSWGQSPGQPVQGGSEAWGPGTLAAAPEGLEDAGLDPHFVPTELWPQEAVPLGLGLEDADWTQGLPWRFEELLTCSHWPSFFPS
• Sequence Length: 164

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 46409542
• NCBI GeneID: 400629
• NCBI Accession #: NP_997342.1
• NCBI GenBank Nucleotide #: NM_207459.3
• UniProt Accession #: Q8NA77
• Molecular Weight: 18,469 Da
• NCBI Official Full Name: testis-expressed protein 19
• NCBI Official Synonym Full Names: testis expressed 19
• NCBI Official Symbol: TEX19
• NCBI Protein Information: testis-expressed protein 19; testis-expressed sequence 19 protein
• UniProt Protein Name: Testis-expressed protein 19
• Protein Family: Testis-expressed sequence 19 protein
• UniProt Gene Name: TEX19

Uniprot Description

Required during spermatogenesis and placenta development, participating in the repression of retrotransposable elements and prevent their mobilization. Collaborates with the Piwi-interacting RNA (piRNA) pathway, which mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins. Interacts with Piwi proteins and directly binds piRNAs, a class of 24 to 30 nucleotide RNAs that are generated by a Dicer-independent mechanism and are primarily derived from transposons and other repeated sequence elements. Also during spermatogenesis, promotes, with UBR2, SPO11-dependent recombination foci to accumulate and drive robust homologous chromosome synapsis (). Interacts with LINE-1 retrotransposon encoded LIRE1, stimulates LIRE1 polyubiquitination, mediated by UBR2, and degradation, inhibiting LINE-1 retranstoposon mobilization (PubMed:28806172).