Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Trans-2,3-enoyl-CoA reductase (Tecr) Recombinant Protein | Tecr recombinant protein

Recombinant Mouse Trans-2,3-enoyl-CoA reductase (Tecr)

Gene Names
Tecr; SC2; Gpsn2; AI173355; D17Ertd178e; 2410016D23Rik; A230102P12Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Trans-2; 3-enoyl-CoA reductase (Tecr); Recombinant Mouse Trans-2; Tecr recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-308aa; full length protein
Sequence
MKHYEVEIRDAKTREKLCFLDKVEPQATISEIKTLFTKTHPQWYPARQSLRLDPKGKSLK DEDVLQKLPVGTTATLYFRDLGAQISWVTVFLTEYAGPLFIYLLFYFRVPFIYGRKYDFT SSRHTVVHLACMCHSFHYIKRLLETLFVHRFSHGTMPLRNIFKNCTYYWGFAAWMAYYIN HPLYTPPTYGVQQVKLALAVFVICQLGNFSIHMALRDLRPAGSKTRKIPYPTKNPFTWLF LLVSCPNYTYEVGSWIGFAILTQCVPVALFSLVGFTQMTIWAKGKHRSYLKEFRDYPPLR MPIIPFLL
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Tecr recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36,090 Da
NCBI Official Full Name
very-long-chain enoyl-CoA reductase isoform 2
NCBI Official Synonym Full Names
trans-2,3-enoyl-CoA reductase
NCBI Official Symbol
Tecr
NCBI Official Synonym Symbols
SC2; Gpsn2; AI173355; D17Ertd178e; 2410016D23Rik; A230102P12Rik
NCBI Protein Information
very-long-chain enoyl-CoA reductase
UniProt Protein Name
Very-long-chain enoyl-CoA reductase
UniProt Gene Name
Tecr
UniProt Synonym Gene Names
Gpsn2; TER
UniProt Entry Name
TECR_MOUSE

Uniprot Description

GPSN2: Reduces trans-2,3-stearoyl-CoA to stearoyl-CoA of long and very long chain fatty acids. Defects in TECR are the cause of mental retardation autosomal recessive type 14 (MRT14). Mental retardation is characterized by significantly below average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period. Belongs to the steroid 5-alpha reductase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 1.3.1.93; Membrane protein, integral; Oxidoreductase; Membrane protein, multi-pass; Lipid Metabolism - unsaturated fatty acid biosynthesis

Cellular Component: cytoplasm; endoplasmic reticulum; integral to endoplasmic reticulum membrane; integral to membrane; membrane; nucleus

Molecular Function: oxidoreductase activity; oxidoreductase activity, acting on the CH-CH group of donors

Biological Process: fatty acid biosynthetic process; fatty acid elongation; fatty acid metabolic process; lipid metabolic process; steroid biosynthetic process; very-long-chain fatty acid biosynthetic process

Research Articles on Tecr

Similar Products

Product Notes

The Tecr tecr (Catalog #AAA7031154) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-308aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Tecr tecr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MKHYEVEIRD AKTREKLCFL DKVEPQATIS EIKTLFTKTH PQWYPARQSL RLDPKGKSLK DEDVLQKLPV GTTATLYFRD LGAQISWVTV FLTEYAGPLF IYLLFYFRVP FIYGRKYDFT SSRHTVVHLA CMCHSFHYIK RLLETLFVHR FSHGTMPLRN IFKNCTYYWG FAAWMAYYIN HPLYTPPTYG VQQVKLALAV FVICQLGNFS IHMALRDLRP AGSKTRKIPY PTKNPFTWLF LLVSCPNYTY EVGSWIGFAI LTQCVPVALF SLVGFTQMTI WAKGKHRSYL KEFRDYPPLR MPIIPFLL. It is sometimes possible for the material contained within the vial of "Trans-2,3-enoyl-CoA reductase (Tecr), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.