SDS-PAGE
Transcobalamin-1 (TCN1) Recombinant Protein | TCN1 recombinant protein
Recombinant Pig Transcobalamin-1 (TCN1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Transcobalamin-1 (TCN1); Recombinant Pig Transcobalamin-1 (TCN1); Cobalophilin; Haptocorrin; Protein R; Transcobalamin I; TCN1 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
25-416aa; Full Length of Mature Protein
Sequence
CVVSEKDYSHLRLLISAMDNLEQIRGIYGASILLSQRLAGIQNPSLEEELSQRIQDDMNRRDMSNLTSGQLALIILAFGACKTPDVRFIHDHHLVEKLGEKFKEEIKNMEIHNSNPLTNYYQLSFDVLTLCLFRGNYSISNVTHYFNPENKNFNLSGHFSVDTGAVAVLALTCVKRSISNGKIKAAIKDSDTIQKYIESLVHKIQSEKMVVSLETRIAQEKLCRLSLSHQTITKMNQIAKKLWTRCLTHSQGVFRLPIAAAQILPALLGKTYLDVTKLLLVPKVQVNITDEPVPVVPTLSPENISVIYCVKINEISNCINITVFLDVMKAAQEKNSTIYGFTMTETPWGPYITSVQGIWANNNERTYWEHSEQQQITKPRSMGIMLSKMESI
Sequence Length
417
Species
Sus scrofa (Pig)
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for TCN1 recombinant protein
Binds vitamin B12 with femtomolar affinity and protects it from the acidic environment of the stomach. Binds to cobalamin and to cobalamin analogs such as cobinamide.
Product Categories/Family for TCN1 recombinant protein
References
"Isolation and characterization of a cDNA encoding porcine gastric haptocorrin." Hewitt J.E., Seetharam B., Leykam J.F., Alpers D.H. Eur. J. Biochem. 189:125-130(1990)
NCBI and Uniprot Product Information
NCBI GI #
UniProt Accession #
Molecular Weight
48.3 kDa
NCBI Official Full Name
Transcobalamin-1
UniProt Protein Name
Transcobalamin-1
Protein Family
UniProt Gene Name
TCN1
UniProt Synonym Gene Names
TC-1; TC I; TCI
Uniprot Description
Binds vitamin B12 with femtomolar affinity and protects it from the acidic environment of the stomach (). Binds to cobalamin and to cobalamin analogs such as cobinamide.
Similar Products
Product Notes
The Transcobalamin-1 (TCN1) tcn1 (Catalog #AAA7053535) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 25-416aa; Full Length of Mature Protein. The amino acid sequence is listed below: CVVSEKDYSH LRLLISAMDN LEQIRGIYGA SILLSQRLAG IQNPSLEEEL SQRIQDDMNR RDMSNLTSGQ LALIILAFGA CKTPDVRFIH DHHLVEKLGE KFKEEIKNME IHNSNPLTNY YQLSFDVLTL CLFRGNYSIS NVTHYFNPEN KNFNLSGHFS VDTGAVAVLA LTCVKRSISN GKIKAAIKDS DTIQKYIESL VHKIQSEKMV VSLETRIAQE KLCRLSLSHQ TITKMNQIAK KLWTRCLTHS QGVFRLPIAA AQILPALLGK TYLDVTKLLL VPKVQVNITD EPVPVVPTLS PENISVIYCV KINEISNCIN ITVFLDVMKA AQEKNSTIYG FTMTETPWGP YITSVQGIWA NNNERTYWEH SEQQQITKPR SMGIMLSKME SI. It is sometimes possible for the material contained within the vial of "Transcobalamin-1 (TCN1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
