TAR DNA-binding protein 43 (TARDBP) Recombinant Protein | TARDBP recombinant protein
Recombinant Chicken TAR DNA-binding protein 43 (TARDBP)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
TAR DNA-binding protein 43 (TARDBP); Recombinant Chicken TAR DNA-binding protein 43 (TARDBP); TARDBP recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-414, Full length protein
Sequence
MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMWGVRLVEGILHAPEAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDIKTGHSKGFGFVRFTDYETQVKVMSQRHMIDGRWCDCKLPNSKQSPDEPLRSRKVFVGRCTEDMTADELQQFFAQYGEVVDVFIPKPFRAFAFVTFADDQVAQSLCGEDLIIKGISVHISNAEPKHNSNRQLERGGRFGGNPGGFGNQGGFGNSRGGGGGLGNNQGSNMGGGMNFGAFSINPAMMAAAQAALQSSWGMMGMLASQQNQSGPSGNNQPQGNMQREQNQGFSSGNNSYGGSNSGAAIGWGSASNAGSSSGFNGGFGSSMDSKSSGWGM
Sequence Length
414
Species
Chicken
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for TARDBP recombinant protein
HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. This protein is a transcriptional repressor that binds to chromosomally integrated TAR DNA and represses HIV-1 transcription. In addition, this protein regulates alternate splicing of the CFTR gene. A similar pseudogene is present on chromosome 20.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44,590 Da
NCBI Official Full Name
TAR DNA-binding protein 43
NCBI Official Synonym Full Names
TAR DNA binding protein
NCBI Official Symbol
TARDBP
NCBI Protein Information
TAR DNA-binding protein 43
UniProt Protein Name
TAR DNA-binding protein 43
Protein Family
UniProt Gene Name
TARDBP
UniProt Synonym Gene Names
TDP43; TDP-43
Uniprot Description
Probably involved in transcriptional repression.
Similar Products
Product Notes
The TARDBP tardbp (Catalog #AAA1477056) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-414, Full length protein. The amino acid sequence is listed below: MSEYIRVTED ENDEPIEIPS EDDGTVLLST VTAQFPGACG LRYRNPVSQC MWGVRLVEGI LHAPEAGWGN LVYVVNYPKD NKRKMDETDA SSAVKVKRAV QKTSDLIVLG LPWKTTEQDL KEYFSTFGEV LMVQVKKDIK TGHSKGFGFV RFTDYETQVK VMSQRHMIDG RWCDCKLPNS KQSPDEPLRS RKVFVGRCTE DMTADELQQF FAQYGEVVDV FIPKPFRAFA FVTFADDQVA QSLCGEDLII KGISVHISNA EPKHNSNRQL ERGGRFGGNP GGFGNQGGFG NSRGGGGGLG NNQGSNMGGG MNFGAFSINP AMMAAAQAAL QSSWGMMGML ASQQNQSGPS GNNQPQGNMQ REQNQGFSSG NNSYGGSNSG AAIGWGSASN AGSSSGFNGG FGSSMDSKSS GWGM. It is sometimes possible for the material contained within the vial of "TAR DNA-binding protein 43 (TARDBP), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
