Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Transcription initiation factor TFIID subunit 7 (Taf7) Recombinant Protein | Taf7 recombinant protein

Recombinant Mouse Transcription initiation factor TFIID subunit 7 (Taf7)

Gene Names
Taf7; 55kDa; Taf2f; TAFII55; AI607308; BB007175
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Transcription initiation factor TFIID subunit 7 (Taf7); Recombinant Mouse Transcription initiation factor TFIID subunit 7 (Taf7); Taf7 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-341, full length protein
Sequence
MSKNKDDAPHELESQFILRLPPEYAATVRRAVQSGHVNLKDKLSIELHPDGRHGIVRVDRVPLAAKLVDLPCVTESLKTIDKKTFYKTADISQMLVATVDGDLYPPVEEAAATADPKANKKKDKDKEKKFVWNHGITLPLKNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDETKETENQGLDISSPGMSGHRQGHDSLEHDELREIFNDLSSSSEDEEDVNILDTEEDLERQLQDKLNESDEQHQENEGTNQLVMGIQKQIDNMKGKLQETQDRAKRQEDLIMKVENLALKNRFQAVLDELKQKEDREKEQLSSLQEELESLLEK
Sequence Length
341
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Taf7 recombinant protein
The intronless gene for this transcription coactivator is located between the protocadherin beta and gamma gene clusters on chromosome 5. This protein is a component of the TFIID protein complex, a complex which binds to the TATA box in class II promoters and recruits RNA polymerase II and other factors. This particular subunit interacts with the largest TFIID subunit, as well as multiple transcription activators. The protein is required for transcription by promoters targeted by RNA polymerase II.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39,126 Da
NCBI Official Full Name
transcription initiation factor TFIID subunit 7
NCBI Official Synonym Full Names
TATA-box binding protein associated factor 7
NCBI Official Symbol
Taf7
NCBI Official Synonym Symbols
55kDa; Taf2f; TAFII55; AI607308; BB007175
NCBI Protein Information
transcription initiation factor TFIID subunit 7
UniProt Protein Name
Transcription initiation factor TFIID subunit 7
UniProt Gene Name
Taf7
UniProt Synonym Gene Names
Taf2f; TAF(II)55; TAFII-55; TAFII55

Uniprot Description

Functions as a component of the DNA-binding general transcription factor complex TFIID, a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors. Present in both of the previously described TFIID species which either lack or contain TAFII30 (TFIID alpha and TFIID beta respectively).

Research Articles on Taf7

Similar Products

Product Notes

The Taf7 taf7 (Catalog #AAA1354687) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-341, full length protein. The amino acid sequence is listed below: MSKNKDDAPH ELESQFILRL PPEYAATVRR AVQSGHVNLK DKLSIELHPD GRHGIVRVDR VPLAAKLVDL PCVTESLKTI DKKTFYKTAD ISQMLVATVD GDLYPPVEEA AATADPKANK KKDKDKEKKF VWNHGITLPL KNVRKRRFRK TAKKKYIESP DVEKEVKRLL STDAEAVSTR WEIIAEDETK ETENQGLDIS SPGMSGHRQG HDSLEHDELR EIFNDLSSSS EDEEDVNILD TEEDLERQLQ DKLNESDEQH QENEGTNQLV MGIQKQIDNM KGKLQETQDR AKRQEDLIMK VENLALKNRF QAVLDELKQK EDREKEQLSS LQEELESLLE K. It is sometimes possible for the material contained within the vial of "Transcription initiation factor TFIID subunit 7 (Taf7), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.