Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Tumor-associated calcium signal transducer 2 Recombinant Protein | TACSTD2 recombinant protein

Tumor-associated calcium signal transducer 2

Gene Names
TACSTD2; EGP1; GP50; M1S1; EGP-1; TROP2; GA7331; GA733-1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Tumor-associated calcium signal transducer 2; TACSTD2 recombinant protein
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
27-323aa; full length protein
Sequence
HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAVIVVVVVALVAGMAVLVITNRRKSGKYKKVEIKELGELRKEPSL
Sequence Length
323
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for TACSTD2 recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for TACSTD2 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35,709 Da
NCBI Official Full Name
tumor-associated calcium signal transducer 2
NCBI Official Synonym Full Names
tumor-associated calcium signal transducer 2
NCBI Official Symbol
TACSTD2
NCBI Official Synonym Symbols
EGP1; GP50; M1S1; EGP-1; TROP2; GA7331; GA733-1
NCBI Protein Information
tumor-associated calcium signal transducer 2
UniProt Protein Name
Tumor-associated calcium signal transducer 2
UniProt Gene Name
TACSTD2
UniProt Synonym Gene Names
GA733-1; M1S1; TROP2
UniProt Entry Name
TACD2_HUMAN

NCBI Description

This intronless gene encodes a carcinoma-associated antigen. This antigen is a cell surface receptor that transduces calcium signals. Mutations of this gene have been associated with gelatinous drop-like corneal dystrophy.[provided by RefSeq, Dec 2009]

Uniprot Description

TACSTD2: May function as a growth factor receptor. Defects in TACSTD2 are the cause of gelatinous drop-like corneal dystrophy (GDLD); also known as lattice corneal dystrophy type III. GDLD is an autosomal recessive disorder characterized by grayish corneal amyloid deposits that cause severe visual impairment. Belongs to the EPCAM family.

Protein type: Membrane protein, integral; Receptor, misc.

Chromosomal Location of Human Ortholog: 1p32

Cellular Component: basal plasma membrane; cytosol; extracellular space; integral to plasma membrane; lateral plasma membrane; membrane; nucleus

Molecular Function: protein binding; receptor activity

Biological Process: cell proliferation; cell surface receptor linked signal transduction; negative regulation of stress fiber formation

Disease: Corneal Dystrophy, Gelatinous Drop-like

Research Articles on TACSTD2

Similar Products

Product Notes

The TACSTD2 tacstd2 (Catalog #AAA7043424) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 27-323aa; full length protein. The amino acid sequence is listed below: HTAAQDNCTC PTNKMTVCSP DGPGGRCQCR ALGSGMAVDC STLTSKCLLL KARMSAPKNA RTLVRPSEHA LVDNDGLYDP DCDPEGRFKA RQCNQTSVCW CVNSVGVRRT DKGDLSLRCD ELVRTHHILI DLRHRPTAGA FNHSDLDAEL RRLFRERYRL HPKFVAAVHY EQPTIQIELR QNTSQKAAGD VDIGDAAYYF ERDIKGESLF QGRGGLDLRV RGEPLQVERT LIYYLDEIPP KFSMKRLTAG LIAVIVVVVV ALVAGMAVLV ITNRRKSGKY KKVEIKELGE LRKEPSL. It is sometimes possible for the material contained within the vial of "Tumor-associated calcium signal transducer 2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual