Brachyury protein (t) Recombinant Protein | tbxt.S recombinant protein
Recombinant Xenopus laevis Brachyury protein (t)
Gene Names
tbxt.S; t; bu; ta; bra; ntl; t-a; t-b; t.L; t.S; xbra; X-bra; brachyury; Xbrachyury
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Brachyury protein (t); Recombinant Xenopus laevis Brachyury protein (t); tbxt.S recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-432, Full length protein
Sequence
MSATESCAKNVQYRVDHLLSAVENELQAGSEKGDPTEKELKVSLEERDLWTRFKELTNEMIVTKNGRRMFPVLKVSMSGLDPNAMYTVLLDFVAADNHRWKYVNGEWVPGGKPEPQAPSCVYIHPDSPNFGAHWMKDPVSFSKVKLTNKMNGGGQIMLNSLHKYEPRIHIVRVGGTQRMITSHSFPETQFIAVTAYQNEEITALKIKHNPFAKAFLDAKERNDYKDILDEGIDSQHSNFSQLGTWLIPNGGSLCSPNPHTQFGAPLSLSSPHGCERYSSLRNHRSAPYPSPYTHRNNSPNNLADNSSACLSMLQSHDNWSTLQMPAHTGMLPMSHSTGTPPPSSQYPSLWSVSNSAITPVSQSGGITNGISSQYLLGSTPHYSSLSHAVPSPSTGSPLYEHGAQTEIAENQYDVTAHSRLSSTWTPVAPPSV
Sequence Length
432
Species
Xenopus laevis (African clawed frog)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
47,599 Da
NCBI Official Full Name
brachyury protein
NCBI Official Synonym Full Names
T-box transcription factor T S homeolog
NCBI Official Symbol
tbxt.S
NCBI Official Synonym Symbols
t; bu; ta; bra; ntl; t-a; t-b; t.L; t.S; xbra; X-bra; brachyury; Xbrachyury
NCBI Protein Information
brachyury protein
UniProt Protein Name
Brachyury protein
UniProt Gene Name
t
UniProt Synonym Gene Names
bra; xBRA
Uniprot Description
Involved in the transcriptional regulation of genes required for mesoderm formation and differentiation. Causes dorsal mesodermal differentiation of animal cap ectoderm when co-expressed with wnt8 and noggin. None of these molecules causes dorsal mesoderm formation when expressed alone. Establishes the left/right axis at early gastrula stage by directly up-regulating mesodermal expression of zic3.
Research Articles on tbxt.S
Similar Products
Product Notes
The tbxt.S t (Catalog #AAA1027798) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-432, Full length protein. The amino acid sequence is listed below: MSATESCAKN VQYRVDHLLS AVENELQAGS EKGDPTEKEL KVSLEERDLW TRFKELTNEM IVTKNGRRMF PVLKVSMSGL DPNAMYTVLL DFVAADNHRW KYVNGEWVPG GKPEPQAPSC VYIHPDSPNF GAHWMKDPVS FSKVKLTNKM NGGGQIMLNS LHKYEPRIHI VRVGGTQRMI TSHSFPETQF IAVTAYQNEE ITALKIKHNP FAKAFLDAKE RNDYKDILDE GIDSQHSNFS QLGTWLIPNG GSLCSPNPHT QFGAPLSLSS PHGCERYSSL RNHRSAPYPS PYTHRNNSPN NLADNSSACL SMLQSHDNWS TLQMPAHTGM LPMSHSTGTP PPSSQYPSLW SVSNSAITPV SQSGGITNGI SSQYLLGSTP HYSSLSHAVP SPSTGSPLYE HGAQTEIAEN QYDVTAHSRL SSTWTPVAPP SV. It is sometimes possible for the material contained within the vial of "Brachyury protein (t), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
